KEGG   Hydrogenophaga sp. RAC07: BSY239_1762Help
Entry
BSY239_1762       CDS       T04455                                 

Definition
(GenBank) ATP dependent DNA ligase domain protein
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hyr  Hydrogenophaga sp. RAC07
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:hyr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BSY239_1762
   03410 Base excision repair
    BSY239_1762
   03420 Nucleotide excision repair
    BSY239_1762
   03430 Mismatch repair
    BSY239_1762
Enzymes [BR:hyr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BSY239_1762
    6.5.1.6  DNA ligase (ATP or NAD+)
     BSY239_1762
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BSY239_1762
DNA replication proteins [BR:hyr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BSY239_1762
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BSY239_1762
DNA repair and recombination proteins [BR:hyr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BSY239_1762
   NER (nucleotide excision repair)
    Other NER factors
     BSY239_1762
   MMR (mismatch exicision repair)
    Other MMR factors
     BSY239_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1862820..1863671
Genome map
AA seq 283 aa AA seqDB search
MKRRELLGVLGLLWAGLSGASRAGDTPALMLAKVYRPGVPLRDYWLSEKYDGLRACWDGQ
RLLTRGGEAITAPDWFTAGWSAESMDGELWIGRGRFEETLSTVRRLTPGEDAWRRVRFMV
FDLPAHPGRFTERIQAYQTLVKRLNQPWVQAVAQERVASNAELMARLDRLVKAGGEGLML
HRGDSFYRAEWNDELLKVKTHEDAEARVLQHLPGQGRHAGRLGALLVETPEGARFRLGTG
FSDAQRDHPPAVGEWVTYRFRGVNGSGVPRFASFVRVRPDAPR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcggcgcgaactgctcggcgtgctgggcctcctttgggctggcctgtccggtgct
tcgcgggctggcgacactcccgccttgatgctcgccaaggtctaccgacccggtgtgccg
ctgcgcgactactggctgagtgaaaaatacgacggcctgcgcgcctgctgggatggccag
cggctgctgacccggggcggtgaggccatcaccgcacccgactggttcacggccggctgg
tccgccgagtccatggacggtgaactctggatcggccgcgggcgttttgaagagacgctc
tccacggtgcgccgactgacccctggcgaagatgcgtggcggcgggttcgcttcatggtg
ttcgacttgcccgcccacccggggcgtttcaccgaacgcatccaggcctaccagacgctt
gtgaaaagactcaaccagccctgggtgcaggccgtcgctcaagagcgcgtcgccagcaac
gccgagttgatggcccgactggaccgtctggtgaaagccggcggcgagggtctgatgctg
caccggggcgattcgttctaccgcgccgagtggaacgacgagctgctgaaggtgaagacg
cacgaagacgccgaggcccgcgtgctgcagcacctgccgggccagggccgccacgccggc
cgcctgggtgccctgctggtcgaaacgcccgagggcgccaggttccgcctgggcaccggc
ttctccgatgcccagcgtgaccatccacccgcggtgggcgaatgggtcacctaccgcttt
cgcggcgtcaatgggagcggcgtgccgcgcttcgccagtttcgtgcgggtgcggcctgac
gcaccacgctga

DBGET integrated database retrieval system