KEGG   Hydrogenophaga sp. RAC07: BSY239_3707Help
Entry
BSY239_3707       CDS       T04455                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
hyr  Hydrogenophaga sp. RAC07
Brite
Translation factors [BR:hyr03012]
 Eukaryotic Type
  Elongation factors
   BSY239_3707 (tuf)
 Prokaryotic Type
   BSY239_3707 (tuf)
Mitochondrial biogenesis [BR:hyr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BSY239_3707 (tuf)
Exosome [BR:hyr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BSY239_3707 (tuf)
  Exosomal proteins of breast cancer cells
   BSY239_3707 (tuf)
  Exosomal proteins of colorectal cancer cells
   BSY239_3707 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase Lsm_C AAA_29
Motif
Other DBs
NCBI-ProteinID: AOF87527
UniProt: A0A1B3M4A9
LinkDB All DBs
Position
complement(3936029..3937219)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAAKFGGAAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAVLVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLDKYDFPGDATPIIHGSAKLALE
GDKGPLGEEAIMKLADALDTYIPTPDRAVDGAFLMPVEDVFSISGRGTVVTGRIERGIVK
VGEEIEIVGISDTQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVQRGQVLCKPGS
IKPHTHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPEGKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagagaaatttgagcggaccaagccgcacgtcaacgttggcaccattggtcac
gttgaccacggcaagaccacgctgacggcggcgatcacgaccgtgctggcggccaagttt
ggcggtgccgccaaggcctacgaccagatcgacgcagcgcccgaagagaaggcccgcggc
atcacgatcaacaccgcgcacgtggaatacgaaacggccaaccgccactacgcccacgtg
gactgccccggccacgccgactatgtgaagaacatgatcaccggagccgcccagatggac
ggcgccgtgctggtgtgctcggccgctgacggccccatgccccagacccgcgagcacatc
ctgctggcccgccaggtgggcgtgccttacatcatcgtgttcctgaacaagtgcgacatg
gtcgacgacgccgagttgctcgagctggtcgagatggaagtgcgcgagctgctggacaag
tacgacttccccggcgacgccacccccatcatccacggctcggccaagctcgccctggaa
ggcgacaagggcccgctgggcgaagaagccatcatgaagctggccgatgcgctggacacc
tacatccccacgcccgaccgtgccgttgacggcgcgttcctgatgcccgtggaagacgtg
ttctccatctcgggccgcggcaccgtggtgaccggccgtatcgagcgcggtatcgtcaag
gtcggcgaagagatcgagatcgtcggtatctccgacacccagaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccagggccaggctggcgacaacgtcggtatcctg
ctgcgcggcaccaagcgcgaagacgtgcagcgcggccaggtgctgtgcaagcccggctcg
atcaagccgcacacgcacttcaccggcgagatctacgtgctgtccaaagacgaaggtggc
cgtcacacgccgttcttcaacaactaccgcccgcagttctacttccgcacgaccgacgtg
accggctcgatcgagctgcccgaaggcaaggaaatggtcatgcccggtgacaacgtgtcg
atcacggtcaagctgatcaaccccatcgccatggaagaaggcctgcgcttcgccatccgc
gaaggcggtcgtaccgttggcgccggcgtcgttgccaaaatcatcgcgtaa

DBGET integrated database retrieval system