KEGG   Hydrogenobaculum sp. SN: HydSN_0078Help
Entry
HydSN_0078        CDS       T02516                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
hys  Hydrogenobaculum sp. SN
Brite
Enzymes [BR:hys01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HydSN_0078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(64178..64801)
Genome map
AA seq 207 aa AA seqDB search
MKLEPKNHLKPSNLNGISNEQIEPHFEAHYKGYVAKFNEIQDKLADLNFSDRSKANQNYS
EYRELKVEETFNYMGTVLHELYFGHLTPKGAPSEALKKKVEEDFGSWDNCVTELKAAGIA
FRGWAILGLDIFSGKLMVNGLDAHNVYNLTGLIPLIVLDTYEHAYYVDQKNKRPPYIDAF
LNSLNWDVINERFEKAIKAYETLKGFC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagaaccaaagaatcatctaaaaccatcaaacctaaacggtatatccaacgaa
cagatagagccacactttgaagctcactacaaaggctatgtggctaagtttaatgaaatc
caagataaactggcagatttaaacttttcagacaggtcaaaagccaatcaaaactattca
gaatatagagagctaaaagtagaagaaaccttcaactatatgggtacagtcttgcatgag
ctttactttggacatctaaccccaaagggtgctccatcagaagctctcaagaaaaaagta
gaagaagattttggctcttgggataactgcgtaacagagttaaaagcagcaggtatagct
tttagaggatgggctattttgggtcttgatatattctcaggtaagctcatggtaaacggt
cttgacgctcacaacgtttacaaccttacagggcttatcccacttatagtgttggatacc
tatgaacacgcatactatgtagaccaaaagaacaaacgcccaccttacatagacgctttc
ttaaattctctaaattgggacgtaataaacgaaagattcgaaaaagctataaaagcttac
gaaacactaaaaggtttttgttaa

DBGET integrated database retrieval system