KEGG   Hymenobacter sp. PAMC 26628: AXW84_01580Help
Entry
AXW84_01580       CDS       T04961                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
hyz  Hymenobacter sp. PAMC 26628
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hyz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AXW84_01580
  Amino acid metabolism
   00310 Lysine degradation
    AXW84_01580
   00380 Tryptophan metabolism
    AXW84_01580
Enzymes [BR:hyz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AXW84_01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
271274..274198
Genome map
AA seq 974 aa AA seqDB search
MDSYSYIANADAVAIETLYQAYQQNPESVDFGWRKFFEGFDFSQQFPAEGAPATNGNGAA
VAPAGLVTAPAAPAAPQPNDYGVLNTVASTNNAPAGLVSSESAPSDKETAVRNLIHAFRS
RGHLRAKTNPVRERKDRQPRLDLPDFGLSDADLDTAFRNGEMLGLGPQAKLRDIIAALEK
IYTGTVGFEYMYIRDPEVLDWLREKIEREALAFNPGVEYKKRILKKLNEAVVFENFLHTK
FLGQKRFSLEGGETTIPALDAIIGKGADLGVQEVMIGMAHRGRLNVLANIMGKTYEQIFS
EFEGTAIPDLTMGDGDVKYHMGYSSEVETANGKKVNLKLAPNPSHLEAVNPVVEGFVRAK
IEHQYAGDYHKILPILIHGDAALAGQGIGYELTQMSQLEGYKTGGTVHFVINNQVGFTTD
FEDARSSIYCTDLAKMIDAPVIHVNGDDPEAVVFAAQLAAEYRQQFHADFFIDMVCYRRH
GHNESDEPKFTQPTLYNIISKHQNPREVYNATLVQRGDVDAELANQMDKEFRDTLQARLD
LVKQKPLPYKYQALENEWRSLRRSTNEDFAQSPETGVSEEVVAKVAKALTTIPDGFKPIK
QIDNLLRERRKMFYETRVLNWAAGELLAYGSLLTENHIVRVSGQDVQRGTFSHRHAVLHD
AETSAPYNSLNHLEGEHQQLSIFNSLLSEYAVLGFEFGYGMANPTALVVWEAQFGDFANG
AQTMIDQFVVSSESKWQRMNGLVMLLPHGYEGQGPEHSNARPERFLQLAAENNIVVANVT
TPANFFHLLRRQLTWSFRKPLVVMSPKSMLRNPLCVSPIDEFTSGRFREVLADDYAEARK
VKRVLLCSGKVYYDLLDEQRTSNRTDVALVRVEQLHPFPQQQLQAELAKYPKAKVYWVQE
EPENMGYWNYLLRFMRRELEDVVARKPSASPATGYNKIHIKEQKDLVARAFDNPKEAVAT
EQIKETAAIAKKQD
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atggattcctactcgtatatcgccaacgctgatgcggtggccatcgaaaccctgtaccaa
gcgtaccagcaaaaccccgaatcggtagattttggctggcgcaaatttttcgaagggttt
gatttctcgcagcaattcccagccgagggggccccggccaccaatggcaacggtgctgcg
gtggcgcccgccggcctggtaacggcgcccgctgcgccggccgcgccccagcccaacgac
tacggcgtgctgaacaccgtggcctcgaccaacaacgccccggccggcctagtgagcagc
gaaagtgcgcccagcgacaaggagacggccgtccgcaacctcatccacgccttccgcagc
cgcggccacctgcgcgccaaaaccaacccggtgcgcgagcgcaaggaccgccagccccgc
ctcgacctgcccgactttgggctgagcgacgccgacttggacacggctttccgcaacggc
gaaatgctgggcctggggccccaggccaagttgcgcgacatcattgcggcgctggaaaaa
atttacaccggcacggtgggcttcgagtacatgtacatccgcgacccggaggtgctggac
tggctgcgcgagaaaatcgagcgcgaagccctggccttcaaccccggcgtggagtacaaa
aagcgcatcctcaagaagctgaacgaggcggtggtgttcgagaacttcttgcacaccaag
ttcttggggcagaagcgcttctcgctcgaaggcggcgaaaccaccattccggccctggac
gccatcattggcaagggcgctgatttgggggtgcaggaagtgatgattggcatggcccac
cgcggccgcctgaacgtgctggccaacatcatgggcaaaacgtacgagcagattttctcg
gagtttgagggcacggccatccccgacctcaccatgggcgacggcgacgtgaagtaccac
atgggctactcgtcggaggtggaaacggctaatggcaagaaagttaacctgaagctggcc
cccaacccctcgcacctcgaggcggtgaacccggtagtggaaggctttgtgcgcgccaaa
atcgagcaccagtacgccggcgactaccacaaaatcctgcccatcctcatccacggcgac
gcggcgctggccggccagggcatcggctacgagctgacccagatgtcgcagctggaaggc
tacaaaaccggcggcacggtgcacttcgtcatcaacaaccaggtgggctttaccactgat
tttgaggacgcccgctcgtcgatttactgcaccgacctggccaagatgattgacgcgccg
gtgattcacgtcaacggcgacgacccggaggccgtggtatttgccgcgcagctcgccgcc
gagtaccgccagcagttccacgccgatttcttcatcgacatggtgtgctaccgccgccac
ggccacaacgagtccgacgagcccaagttcacccagcccacgctctacaacatcatctcg
aagcaccagaacccgcgcgaggtgtacaacgccacgctggtgcagcgcggcgacgtggac
gccgagctggccaaccagatggacaaggagttccgcgatacgctgcaagcccgcctcgac
ttggtgaagcagaaaccgctgccttataagtaccaggccctggaaaatgagtggcgtagc
ctgcgccgcagcaccaacgaagacttcgcccaatcgcctgaaaccggcgtgtcggaggaa
gtggtggcgaaggtggccaaggccctgaccacgattcccgacggcttcaagcccatcaag
cagattgacaacttgctgcgtgagcgccgcaagatgttctacgaaacccgcgtgctgaac
tgggccgccggcgagctactggcctacggctcgctgctgaccgaaaaccacatcgtgcgc
gtgagcggccaggacgtgcagcgcggcacgttctcgcaccgccacgccgtgctgcacgac
gccgaaacctcggcgccctacaactcgctgaaccacctggagggtgagcaccagcagctg
agcatcttcaactcgctgctgagcgagtacgcggtactaggcttcgaatttggctacggc
atggccaaccccacggccctggtggtgtgggaagcgcagttcggcgacttcgccaacggg
gcccaaaccatgatcgaccagttcgtggtgagctccgagagcaagtggcagcgcatgaac
ggcctggtgatgctgctgcctcacggctacgagggccagggccccgagcactccaacgcc
cgccccgagcgcttcctccagctcgccgccgagaacaacattgtggtggccaacgtgacc
acgccggccaacttcttccacctgctgcgccgccagctgacgtggagcttccgcaagccg
ctggtggtgatgtcgcccaagtcgatgctgcgcaacccgctgtgcgtgtcgccgattgac
gagttcaccagcggccgcttccgcgaggtgctggccgacgattacgccgaagccaggaaa
gtgaagcgcgtgctgctgtgctcgggcaaagtgtactacgacctgctcgacgagcagcgc
accagcaaccgcaccgacgtggccctggtgcgcgtggagcagctgcacccctttccgcag
caacaattgcaggccgagctggccaagtaccccaaagccaaggtgtactgggtacaagag
gagcccgagaacatgggctactggaactacctgctccgcttcatgcgccgcgagctggag
gacgtggtagcccgcaagccctcggcctcgccggccaccggctacaacaaaatccacatc
aaggagcagaaagacctcgtggcccgcgccttcgacaaccccaaggaagccgtggccacc
gagcaaataaaggaaacggccgcaatcgccaaaaagcaggactag

DBGET integrated database retrieval system