KEGG   Intrasporangium calvum: Intca_1004Help
Entry
Intca_1004        CDS       T01385                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ica  Intrasporangium calvum
Pathway
ica00473  D-Alanine metabolism
ica01100  Metabolic pathways
ica01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Intca_1004
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Intca_1004
Enzymes [BR:ica01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Intca_1004
Peptidoglycan biosynthesis and degradation proteins [BR:ica01011]
 Precursor biosynthesis
  Racemase
   Intca_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADU47528
UniProt: E6SDA6
LinkDB All DBs
Position
1113598..1114761
Genome map
AA seq 387 aa AA seqDB search
MNSTDATAGLTVWAEIDLDAFEDNVRTLRARAPHSQLMAVVKADGYGHGLLPVARAAVRA
GADWLGVAQPTEAFALRDAGVTTRILTWLSVPGTDFAGAVRRDIDVSASAPWTLDAIAGA
ARSEGRSARVHLKVDTGLGRGGAFGTDWPTLVEHARRLESEGAISVVGIWTHFAMADAPE
HPTVLAQQDTFFEAVATAERAGVRPEVRHLANSAATLVHPAAHADLVRPGIAMYGLSPVP
EVADDFGLRPVMTLRARLALVKRWPAGRGISYGHVYAPEVDTVVGLVPAGYADGVPRSAT
NVAPVQVGARRTTIAGRVCMDQFVVDLGPDSAAAAGDVVTLFGKPSEGPTAQDWADATET
ISYEIVTRIGARVPRLWSGGAEAGAGA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaactccactgacgcgactgccggcctgaccgtctgggcggagatcgacctggacgcc
ttcgaggacaacgtccgcaccctgcgtgcccgggcgccgcactcgcagctcatggcggtc
gtcaaggcggacggttacgggcacggcctgctcccggtggcccgggcggccgtgcgcgcc
ggagcggactggctcggtgtggcgcagccgaccgaggcgttcgccctgcgggacgccgga
gtcaccacccgcatcctgacctggctctccgtcccgggcaccgacttcgccggggcggtt
cgacgcgacatcgacgtctcggcctcggcgccgtggaccctcgatgccatcgccggagca
gcccggtccgaggggcgctcggcccgggtccacctcaaggtcgacaccgggctcggccgg
ggcggtgccttcggcactgactggcccacgctcgtcgaacacgcccgtcgactggagtcg
gagggagccatctcggtcgtcgggatctggacgcacttcgccatggccgacgcgcccgag
caccccacggtcctggcccagcaggacaccttcttcgaggccgtcgccaccgccgagcga
gccggcgtgcggcccgaggtcagacacctggcgaactcagccgccaccctggtccatccg
gcggcgcacgcagacctcgtgcgacccggcatcgcgatgtacgggctgtcccccgtcccc
gaggtcgcggacgatttcgggctgcgaccggtcatgacgctgcgcgcccgtctcgcgctc
gtcaagaggtggccggcgggtcgcgggatcagctacggccacgtctatgcccccgaggtg
gacacggtggtcggcctcgtcccggccggctacgccgacggcgtcccgcgcagcgcgacc
aacgtggcgccggtccaggtcggggcgcgccggacgacgatcgccggacgggtgtgcatg
gaccagttcgtcgtcgacctcggtccggacagcgccgccgccgccggggacgtcgtcacc
ctcttcggcaagccgtccgaggggccgaccgcgcaggactgggccgacgccaccgagacc
atcagctacgagatcgtcacgcggatcggggcccgcgtccccaggctgtggagtggtggg
gctgaggctggagcgggcgcgtga

DBGET integrated database retrieval system