KEGG   Intrasporangium calvum: Intca_3322Help
Entry
Intca_3322        CDS       T01385                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ica  Intrasporangium calvum
Pathway
ica00220  Arginine biosynthesis
ica00250  Alanine, aspartate and glutamate metabolism
ica00290  Valine, leucine and isoleucine biosynthesis
ica01100  Metabolic pathways
ica01110  Biosynthesis of secondary metabolites
ica01130  Biosynthesis of antibiotics
ica01210  2-Oxocarboxylic acid metabolism
ica01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ica00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Intca_3322
   00290 Valine, leucine and isoleucine biosynthesis
    Intca_3322
   00220 Arginine biosynthesis
    Intca_3322
Enzymes [BR:ica01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Intca_3322
    2.6.1.66  valine---pyruvate transaminase
     Intca_3322
Amino acid related enzymes [BR:ica01007]
 Aminotransferase (transaminase)
  Class I
   Intca_3322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ADU49805
UniProt: E6SEC8
LinkDB All DBs
Position
complement(3672974..3674188)
Genome map
AA seq 404 aa AA seqDB search
MRLVSQSKKLASVCYEIRGPVLAEAKRLEDEGHRILKLNIGNPAPFGFEAPDDILVDVIR
ALPTAQGYSDSKGIVSARRAIKQHYEVRDFPRLDIEDIYLGNGVSELIVMAMQGLLNNGD
EVLIPAPDYPLWTAAASLAGGTPVHYLCDEQAGWAPDLDDIASKITDRTKAIVVINPNNP
TGAVYPVDVLEGIAELARRHQLIIMADEIYDKILYDDAKHTSIAALAPDLFCLTFNGLSK
AYRVAGFRSGWLALTGPKEHARSYIEGLEVLANMRLCANVPAQHAIQVALGGYQSITELI
LPGGRLLEQRDRAWEMLNQIPGVSCTKPEGALYLFPRLDPKVHQIRDDERFAFDLLSEEK
LLVVHGTGFNWPSHDHFRLVFLPRVEELEDAMERIERFLSTYSQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgtctcccagtccaagaagctcgcgtccgtctgctacgagatccgcggaccg
gtgctcgccgaggccaaacggctcgaggacgaggggcaccggatcctcaagctcaacatc
ggcaacccggcgccgttcggcttcgaggcgccggacgacatcctcgtcgacgtgatccgc
gcgctgccgaccgcacagggttacagcgacagcaagggcatcgtcagcgcgcgacgcgcc
atcaagcagcactacgaggtccgcgacttcccccgtctcgacatcgaggacatctacctg
ggaaacggcgtcagcgagctcatcgtcatggcgatgcagggcctgctcaacaacggcgac
gaggtcctcatcccggcgccggactacccgctgtggacggccgccgcgtccctggccggc
gggaccccggtgcactacctctgcgacgagcaggcgggctgggcgcccgacctcgacgac
atcgcgagcaagatcaccgaccggaccaaggcgatcgtcgtcatcaacccgaacaacccc
acgggcgccgtctacccggtcgacgtcctcgagggcatcgccgagctggcccgccggcac
cagctgatcatcatggccgacgagatctacgacaagatcctctacgacgacgcgaagcac
acgtcgatcgccgccctcgccccggacctgttctgcctcaccttcaacggcctctccaag
gcgtaccgcgtggccgggttccgttccgggtggctggccctcaccggcccgaaggagcac
gcccgcagctacatcgagggcctcgaggtcctcgcgaacatgcgtctgtgcgccaacgtg
ccggcccagcacgccatccaggtcgccctgggcggctaccagtcgatcaccgagctgatc
ctgccgggcggtcgactcctcgagcagcgcgaccgggcctgggagatgctcaaccagatc
ccgggggtctcgtgcaccaagccggagggtgcgctctacctcttcccgcgcctcgacccc
aaggtccaccagatccgggacgacgagcggttcgccttcgacctgctcagcgaggagaag
ctcctcgtcgtccacgggaccgggttcaactggccctcgcacgaccacttccggctcgtc
ttcctgccgcgggtggaggagctggaggacgcgatggagcggatcgagcgcttcctgtcg
acctacagccagtag

DBGET integrated database retrieval system