KEGG   Idiomarina loihiensis L2TR: IL0361Help
Entry
IL0361            CDS       T00218                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
ilo00240  Pyrimidine metabolism
ilo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    IL0361 (tdk)
Enzymes [BR:ilo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     IL0361 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14 DUF2075
Motif
Other DBs
NCBI-ProteinID: AAV81204
UniProt: Q5QWC7
LinkDB All DBs
Position
377941..378522
Genome map
AA seq 193 aa AA seqDB search
MASLYFTYSAMNAGKSTSLLQVAHNYEERQQHVLLMTPALDDRAGKGRIASRLGIGRDAV
SFTHRTDLAAVVRARYMQQAIDCVLIDEAQFLSEEQVWQLSSLADTDNIPVMCYGIRTDA
FGNAFPGSAVLLAIADKLVEMKTICHCGRKATMSLRVDEQGNAIRMGQQIAIGGNDRYVS
CCRKHWKEAMGLR
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttatatttcacttactcggcaatgaatgcaggcaaaagtacgtcgttattg
caagtggcgcacaattacgaagagcgccaacaacatgtcctgctaatgacgccggcttta
gatgatcgggcaggtaaaggacgtattgcttcccgattaggaattggtcgcgatgcggtg
tctttcacacaccggacagatttagctgccgtagtccgggctcgctacatgcaacaggca
attgactgtgtgttaattgatgaggcgcagtttttaagtgaagagcaggtgtggcaactg
tccagtctggctgacaccgacaatattccggtaatgtgttacggcatccgcaccgacgct
tttggcaacgcctttccgggtagtgcggtgttgttggctatagccgacaaactggtggaa
atgaaaaccatctgccactgcggtcgcaaagcgaccatgtcattgcgggttgacgagcag
ggaaatgcaatacgtatgggacagcaaatagctattggtggcaatgatcgttacgtttcc
tgttgtcgtaaacactggaaagaagccatggggctgcgctaa

DBGET integrated database retrieval system