KEGG   Idiomarina loihiensis L2TR: IL0719Help
Entry
IL0719            CDS       T00218                                 

Definition
(GenBank) Glutathione S-transferase related protein
  KO
K01800  
maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
ilo  Idiomarina loihiensis L2TR
Pathway
Tyrosine metabolism
Styrene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ilo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    IL0719
  Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    IL0719
Enzymes [BR:ilo01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     IL0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(776916..777554)
Genome map
AA seq 212 aa AA seqDB search
MKLYGYWRSSASYRVRIALNLKGLAYEYEPVHLVKDGGQQHSEAYRKLNPARLVPTFIDG
DVRLNQSLAIIEYLEECYPKKPLLPSAPADKARVRALAYDLACELQPVTNLRVLQYLTGE
LNCSDEQRSAWIANWVERSFTAFEQRLTEYAGDYCYGNSVTLADICLIPQVYNAQRFNLD
LTAYPTLMAVHERLQALDAVQQARPENQADAQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatacggctactggcgctcaagcgccagttaccgggttcgtattgcgttaaac
ctcaaagggctggcgtacgagtacgaaccggtgcatttagttaaagacggcggacaacag
cacagtgaggcttatcgaaagcttaatcctgcgcgcttggttcctacttttatagatggt
gacgttaggttaaatcagtctttagccattattgagtatctggaagagtgctatccaaag
aaacctttattgccctccgctccagctgacaaagccagagtcagagccttggcttatgat
ttagcctgcgaactgcaacctgttacaaacttacgagtgctacagtacttaaccggtgag
ctgaattgcagtgacgaacaacgttcagcctggatagctaactgggtagaacgaagtttt
accgcatttgaacagcggcttaccgagtatgcaggtgattattgctatggtaattcggta
acattggctgatatctgtttgatacctcaggtatacaatgcacaacgctttaatttggac
ttaacggcatatccaactttaatggcggtgcatgaacgtttgcaggcgcttgacgcagtg
caacaggctcggcctgaaaatcaagcggatgcacagtaa

DBGET integrated database retrieval system