KEGG   Ipomoea nil (Japanese morning glory): 109177539Help
Entry
109177539         CDS       T04663                                 

Definition
(RefSeq) glutathione S-transferase U25-like
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ini00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    109177539
Enzymes [BR:ini01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109177539
Transporters [BR:ini02000]
 Other Transporters
  Pores ion channels [TC:1]
   109177539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 224 aa AA seqDB search
MSSKQDEVVVLDFWVSPFCMRVKIALEEKGVVGYELKEENLLSGKSDLLLKSNPIYQKVP
VLLHNGNPIVESTNIVYYIDEAWPSSPSLLPSCAYGRARARFWADFVEKKVFDAGAAIWG
GKGGEIEAAKNEFIEVIKKLEGALGEKDYYGGDTFGFVDVIAIPLTSWFPTYERFGGFKV
EEECPRFAGWMKRCQDRESVAKALPDPEKVYEFVIRLRKMRGIE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgaagcaggacgaggttgtcgtgttggacttctgggtgagcccattttgcatg
agggtgaagattgcgttggaagagaaaggcgttgtgggttatgagttgaaggaggaaaac
ttgcttagtgggaagagtgatcttctcttgaaatccaaccctatttaccaaaaagtccct
gtgttattgcacaatgggaaccccattgttgagtccaccaatattgtttactacattgat
gaggcttggccctcctccccttctttgctcccttcttgcgcctatggccgggcccgggct
cggttttgggccgacttcgttgagaaaaaggtatttgatgctggtgctgcaatatgggga
ggcaaagggggagagatagaggctgccaagaatgaattcatagaggtcataaagaagctg
gagggagctctaggggagaaggattactatggcggcgacacgtttgggttcgtggacgtc
atcgccatccccctgacatcctggttcccaacctacgagagattcggagggtttaaggtg
gaggaagagtgcccaaggtttgctggttggatgaagagatgccaggacagggagagtgtt
gccaaggcccttcctgacccggaaaaggtctacgagttcgttatcaggctcaggaaaatg
cgtgggattgaatag

DBGET integrated database retrieval system