KEGG   Ipomoea nil (Japanese morning glory): 109186304Help
Entry
109186304         CDS       T04663                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00010  Glycolysis / Gluconeogenesis
ini00051  Fructose and mannose metabolism
ini00052  Galactose metabolism
ini00500  Starch and sucrose metabolism
ini00520  Amino sugar and nucleotide sugar metabolism
ini01100  Metabolic pathways
ini01110  Biosynthesis of secondary metabolites
ini01200  Carbon metabolism
Module
ini_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ini_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ini00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109186304
   00051 Fructose and mannose metabolism
    109186304
   00052 Galactose metabolism
    109186304
   00500 Starch and sucrose metabolism
    109186304
   00520 Amino sugar and nucleotide sugar metabolism
    109186304
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109186304
Enzymes [BR:ini01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109186304
Membrane trafficking [BR:ini04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109186304
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 109186304
NCBI-ProteinID: XP_019191774
LinkDB All DBs
Position
Un
AA seq 511 aa AA seqDB search
MGKLAVGAGVVCAAAVCVAAALVVRHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVAD
AMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKG
VVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPT
RQTSIASGTLIKWTKGFNIDEMVGEDVVEELTKAMERAGLDMRVAALVNDTVGTLAGGRY
NNPDVVAAVILGTGTNAAYVERANAIPKWHGLLPKSGEMVINTEWGNFRSSHLPLSDYDL
SLDAESLNPGEQIYEKLISGMYLGEIVRRVLCKMAEEAELFGDTVPPKLKIPFILRTPDM
SAMHRDTSADLKVVGNKLKDILEIPNSSLKMRKVVVEVCDIVATRAARLSAAGIVGILKK
LGRDSWKAGESNKRSVVAVDGGLFEHYTKFRDCMESTLKELLGEASESLVIEHSNDGSGI
GAALLAAAHSQYLEADESLWSVAEAVAFPAE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagttggcggtgggggctggggtggtgtgtgcggcggcggtgtgcgtcgcggcg
gcgctcgtggtgaggcaccacatgaggagctccggccggtgggccaagaccgtggcttta
ctgaaagagctggaggagaagtgtgggacgccggccggcaagctccggcaagtcgccgac
gccatggccgtcgagatgcacgccggacttgcatctgagggtggcagcaaactcaagatg
cttattagctacgttgataacctcccctctggggatgaagaaggcctgttttatgcgcta
gacttaggaggtacaaacttccgggtcatgcgtgtgcagttgggagggaaagagaaaggc
gtagttaatagagaatctcaagaagtctcaattccacggcatttgatggttggatcatcc
gaggcactgtttgattttattgcccatgagctcgcaatgtttgtcaagaaagaaggtgaa
gatttccacattccacctgataaacaaagggaattgggcttcaccttttcattcccgact
agacaaacctcgatagcatcgggaactcttataaaatggacaaagggctttaacatagac
gaaatggttggagaagatgttgtagaagagttgacaaaagcaatggaaagagctggcctt
gatatgcgtgtggctgctttggtcaatgatactgttggaacgttagcggggggtcgatat
aacaaccccgatgtcgttgctgcagtcatattgggtactggaaccaatgctgcatatgtg
gagcgggcaaatgcgattccgaaatggcatggtttactgcctaaatcaggagagatggtt
atcaacactgaatggggtaatttccggtcatctcatcttccattatcggactatgatcta
agtctggatgccgagagcctgaacccgggagagcagatatacgagaagctaatttctggc
atgtatctcggagagattgtccggagagtcttgtgcaaaatggctgaagaagccgaactt
tttggtgatactgtcccaccaaagttgaaaattcctttcattttaaggactcctgacatg
tctgcaatgcatcgtgacacatctgctgatctgaaggtggttggcaacaaactaaaggat
attttggagatacccaactcttccttgaaaatgcggaaagtagtggtcgaggtgtgcgac
attgttgcgactcgagcagcccgcctctcggctgcagggatcgtaggcatactcaagaag
ttgggaagggacagttggaaggcgggggagagcaacaagagatccgtcgtggcagtggac
ggagggctgttcgagcactacaccaagttcagagactgtatggagagcacacttaaagag
ctgctgggggaggcgtccgagagcctcgtcatcgagcactcaaacgacggctcgggtatc
ggagctgcgctcttggcggccgctcattcgcagtacctcgaagccgacgaatctctttgg
tcggtggccgaagcagttgcgtttccggcagagtaa

DBGET integrated database retrieval system