KEGG   Ipomoea nil (Japanese morning glory): 29082095Help
Entry
29082095          CDS       T04663                                 

Gene name
rbcL, IPN_cp058
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ini  Ipomoea nil (Japanese morning glory)
Pathway
ini00630  Glyoxylate and dicarboxylate metabolism
ini00710  Carbon fixation in photosynthetic organisms
ini01100  Metabolic pathways
ini01200  Carbon metabolism
Module
ini_M00165  Reductive pentose phosphate cycle (Calvin cycle)
ini_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
ini_M00532  Photorespiration
ini_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:ini00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    29082095 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    29082095 (rbcL)
Enzymes [BR:ini01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     29082095 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 29082095
NCBI-ProteinID: YP_009295112
UniProt: U3R506
LinkDB All DBs
Position
CP
AA seq 480 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYRIERVIGEKDQYIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTAYIKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHIHAGTVVGKLEGEREITLGFVDLLRDDFVEQDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIRQACKWSPELAAACEVWKEIRFEFKPVDTLDPDGN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgtaaaagactac
aaattgacttattatactcctgagtaccaaaccaaagatactgatatcttggcagcattc
cgagtaactcctcaacccggagttccacctgaagaagcaggggccgcggtagctgcggaa
tcttctactggtacatggacaactgtgtggaccgatggacttaccagtcttgatcggtac
aaggggcgatgctaccgcatcgagcgcgttattggagaaaaagatcaatatattgcttat
gtagcttaccctttagacctttttgaagaaggttctgttaccaacatgtttacttccatt
gtgggtaatgtatttgggttcaaagcactgcgcgctctacgtctggaagatttacgaatc
cctacggcttatattaaaacttttcaaggccctcctcatggcatccaagttgagagagat
aaattgaacaagtatggtcgtcctctgttgggatgtactattaaacctaaattggggtta
tctgctaaaaactacggtagagcggtttatgaatgtcttcgcggtggacttgattttacc
aaagatgatgagaacgtaaactcacaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagcaatttataaatcacaggctgaaacaggtgaaatcaaaggacattacttg
aatgctactgcaggtacatgcgaagaaatgatgaaaagagctatatttgctagagaattg
ggagttccgattgtaatgcatgactacttaacagggggattcactgcaaatacttctttg
gctcattattgccgagataatggtctacttcttcacatccaccgtgcaatgcatgcagtt
attgatagacagaagaatcatggtatgcacttccgtgtactagctaaagcgttacgtctg
tctggtggagatcatattcacgcgggtaccgtagtaggtaaacttgaaggggaaagagag
attactttgggctttgttgacttactacgtgatgattttgttgaacaagaccgaagtcgc
ggtatttatttcactcaagattgggtttctttaccaggtgttctgcctgtggcttcaggg
ggtattcacgtttggcatatgcctgctctgaccgagatctttggggatgattccgtacta
cagttcgggggaggaactttagggcacccttggggtaatgcgccaggtgccgtagctaat
cgagtcgctctagaagcatgtgtacaagctcgtaacgaaggacgtgatcttgctcgggaa
ggtaatgaaattattcgccaggcttgcaaatggagccctgaactagctgctgcttgtgag
gtatggaaggagatccgatttgaatttaaaccagtggataccttggatccagatggaaat
taa

DBGET integrated database retrieval system