KEGG   Ictalurus punctatus (channel catfish): 100304675Help
Entry
100304675         CDS       T04658                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    100304675 (sod2)
   04068 FoxO signaling pathway
    100304675 (sod2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100304675 (sod2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    100304675 (sod2)
   04212 Longevity regulating pathway - worm
    100304675 (sod2)
   04213 Longevity regulating pathway - multiple species
    100304675 (sod2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100304675 (sod2)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100304675 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
25
AA seq 224 aa AA seqDB search
MLSRIGHVRRCAAGLNPLLGILASRQKHTLPDLPYDYGALEPHISAEIMQLHHNKHHATY
VNNLNVTEEKYQEALAKGDVTAQVALQAALKFNGGGHINHTIFWTNLSPNGGGEPQGELM
EAIKRDFGSFQKMKEKMSSATVAVQGSGWGWLGYDKENGRLRIAACANQDPLQGTTGLVP
LLGIDVWEHAYYLQYKNVRPDYVKAIWNITNWENVNERFQAAKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttgagcagaattggacatgttcgcaggtgtgcagccggcttgaatcccttgctaggc
attttggcctccagacagaagcacacacttccagatctgccttatgactacggtgcacta
gaacctcacatctcagctgagatcatgcagcttcaccacaacaagcaccatgcaacatac
gtcaacaaccttaatgttactgaagagaaatatcaagaggctctggccaaaggtgatgta
acagcacaagtggcccttcaggcagcactgaagtttaatggcggtggtcacatcaaccac
accatcttctggacaaacctgtcaccgaacggtgggggagaaccacagggtgagctgatg
gaggccattaagcgtgactttggctcattccagaagatgaaggagaagatgtcttctgcc
actgtggcagttcaaggatcaggctggggatggctggggtacgataaggagaacggaagg
ctgaggattgctgcgtgtgcaaaccaagatcctctgcagggaaccactggtctcgtcccg
ctgctcggcattgatgtctgggaacacgcctactatcttcagtacaaaaacgtcagacct
gactacgttaaagccatatggaacattacaaactgggagaatgttaatgagcgctttcaa
gctgccaagaagtaa

DBGET integrated database retrieval system