KEGG   Ictalurus punctatus (channel catfish): 100528722Help
Entry
100528722         CDS       T04658                                 

Gene name
sod1, sodc
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100528722 (sod1)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100528722 (sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
16
AA seq 152 aa AA seqDB search
MKAVCVLKGTGDVTGVVHFEQQVESDPVTVKGKITGLTPGLHGFHVHAFGDNTNGCISAG
PHFNPHKKTHGGPDDEIRHVGDLGNVTADSEGTAIIHIVDKQLSLTGQHSIIGRTMVIHE
KEDDLGKGGNEESLKTGNAGGRLACGVIGIAE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgtttgcgtcctcaaaggaacaggcgacgtgactggcgtagttcactttgag
cagcaggttgaaagtgatccagtaactgtgaaaggaaagatcactggcctgacccctggc
ctgcatggctttcatgtccatgcctttggggacaacacaaatgggtgcatcagtgcagga
cctcacttcaacccccacaagaagacccatggtgggccagatgatgagatcaggcatgtt
ggagatctggggaatgtgactgctgattctgaaggaactgctatcatccacatcgtggac
aaacagttgtcactgaccgggcagcattcgatcataggcaggaccatggtgattcatgag
aaggaggatgacttgggcaaaggtggaaatgaggaaagtcttaaaacaggaaatgcagga
ggtcgtctggcttgtggcgtgataggcattgctgagtga

DBGET integrated database retrieval system