KEGG   Ictalurus punctatus (channel catfish): 108255976Help
Entry
108255976         CDS       T04658                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    108255976
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     108255976
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
22
AA seq 601 aa AA seqDB search
MKAVNSLLLLWSCTLVQEWTLCIGEEENPSLMKSVNPCCYYPCQNRGICMRYGLDRYQCD
CTRTGYYGENCTIPEFWSRVYELMKPSPDVVHYILTHFYWLWSLINNTFLREWIMYKVLT
VRSDLIPSPPTYNSKYGYLNWESYSNITYYTRILPPVPLDCPTPMGAKGKIELPDPKLLV
EKFLLRREFRPDPQGTNLMFGFFAQHFTHQFFKTHNRMGLGFTKGLGHGVDAGHIYGDNL
ERQLSLRLLKDGKLKYQIVNGEMYPPTVAETNVNMNYPPSVPPEKQMAIGQEVFGLLPGL
SMYATLWLREHNRVCDILKKEHPTWGDEQLFQTTRLIIIGETIRIVIEDYVQHLSGYHLK
LKFDPSLLFSSKFQYQNRIAVEFNHLYHWHPLMPNSFFIDGSEISYDGFMFNTSILTHYG
VEKLVQAFSTQPAGQIGGGRNIPHIVARVAEGVIKESRQLRLQPFNEYRKRFNLKPYKSF
HEFAADKEIARELEELYGEIDAMEFYPALLLEKTRPDAIFGQSMVEMGAPFSLKGLMGNP
ICSPEYWKPSTFGGQIGFDIVNSATLQRLVCLNTKWCPYVSFHVPPPGYQQKKSGDTHAE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtgaacagtcttctcctcctgtggtcgtgtactctggtgcaggaatggact
ttatgcatcggtgaggaagaaaacccgtcactgatgaaaagtgtgaatccttgttgctac
tacccttgtcagaaccggggcatttgtatgagatatggactagaccgataccagtgtgac
tgcaccagaactgggtactatggagaaaactgcactatccctgagttctggtccagagtc
tatgagctcatgaagccaagtcctgatgtcgtccactacatcctgacccatttttactgg
ttatggagccttataaataataccttcctgagggagtggatcatgtataaggtccttaca
gtgcgatcagaccttattcccagccctcctacctataactccaagtatggctacctgaac
tgggaatcatattccaatatcacttattacacccgaattctgcctccagtgccactggac
tgcccaacacctatgggtgccaaaggaaaaattgagcttccagatcccaaactgttggtg
gaaaagtttttattgaggcgggaattcaggccagacccccagggtacaaatttaatgttt
ggctttttcgctcagcacttcactcaccagttcttcaaaacacacaatcggatggggctt
ggctttaccaaaggtctaggccacggggtggatgctggacatatttatggagataacctt
gaacgccagctgagtcttagacttctcaaagatgggaagctgaagtaccagatcgtcaat
ggggagatgtacccacctacagtggcagagaccaacgtgaacatgaactaccctccatca
gttccaccagaaaagcaaatggctattgggcaggaggtgtttggcctgttgccaggctta
agcatgtacgccaccctgtggctgcgtgaacacaaccgtgtgtgtgacatcctaaagaaa
gagcatcccacctggggagatgagcaactctttcagaccaccagacttattattataggt
gagactatccgaatagtgattgaggattatgtacagcacctaagtggctaccatctaaag
ctgaagtttgatccatccctgctcttcagctccaaattccagtaccagaaccgcattgcc
gtggagtttaatcacctttatcactggcatccactcatgcccaacagcttcttcattgat
ggaagtgagatctcctatgatgggttcatgttcaacacctccattctgactcactatgga
gtggagaaactggtgcaggctttctcaactcagccagcaggacagattggaggtggccgt
aatattccacatatagtggccagagtagctgaaggagtcattaaagaatctaggcaactt
cggctacagccatttaatgagtaccgcaaaagatttaacctgaaaccatacaaatcattc
catgaatttgcagctgacaaggagatcgcccgtgagttggaagagctctatggagagatt
gatgctatggaattttatcctgctttattgctagagaagacacggcctgatgccatattc
ggacagagcatggtagaaatgggggcgccattttccctaaaaggtcttatgggaaacccc
atatgttcacctgaatactggaagcccagcacttttggaggtcagattggctttgatatt
gtcaactctgctactcttcaaagactggtttgtctcaatactaagtggtgtccttatgta
tccttccatgttcccccgccaggttatcagcagaaaaaatcaggtgacactcatgctgaa
ttgtag

DBGET integrated database retrieval system