KEGG   Ictalurus punctatus (channel catfish): 108265558Help
Entry
108265558         CDS       T04658                                 

Gene name
OGDH
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108265558 (OGDH)
  Amino acid metabolism
   00310 Lysine degradation
    108265558 (OGDH)
   00380 Tryptophan metabolism
    108265558 (OGDH)
Enzymes [BR:ipu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     108265558 (OGDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
5
AA seq 1022 aa AA seqDB search
MHRLRTCAARLRPITASQTAKTPTQQRPTATFRTFQPIRRYTAPVAAEPFLNGTSSNYVE
EMYYAWLENPKSVHKSWDIFFRNANAGAPPGTAYQSPPPLGMGLAELTQAQSLVGAQPNV
EKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGIMDADLDSCVPTDIITSSDKLGFYGLEES
DLDKVFRLPTTTFIGGTESALPLREIIRRLEMSYCQHIGVEFMFINDLDQCQWIRQKFES
PGVMQFSLEEKRTLLARTVRSTRFEEFLQKKWSSEKRFGLEGSDSLIPALKTIIDKSSEC
GVENVVMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINR
VTDKNITLSLVANPSHLEAVNPVVQGKTKAEQFYCGDNGGNRVMSILLHGDAAFAGQGIV
YETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDP
EAVMYVCNVAAEWRATFHKDVVVDLVSYRRNGHNEMDEPMFTQPLMYKQIKKQKPVLLKY
AEKLIAEGVVTRQEYEEEIAKYDKICEEAYARSKDEKILHIKHWLDSPWPGFFTLDGQPK
SMTCPSTGLSEEELTHIGQVASSVPVEDFTIHGGLSRILKARGEMIRNRTVDWALGEYMA
FGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKRTCIPMNHMAPNQAPYTVCNSSL
SEYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLP
HGMEGMGPEHSSARPERFLQMCNDDPDVFPKITDDFAVRQLYDCNWIVVNCSTPANFFHV
LRRQILQPFRKPLIVFTPKSLLRHPEAKSNFDLMLPGTHFLRMIPEEGLAAQDPAAVKRL
IFCTGKVFYELKRERKTRGQENTVAIARVEQLSPFPFDLVKAETEKYPNADLVWCQEEHK
NQGYYDYVKPRMRTTIDRSKPVWYAGREPAAAPATGSKNSHLLELKRFLDTAFNLDAFKD
HI
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgcttaaggacttgtgcggcgcggcttcggccgatcacggcctcacagactgct
aagaccccgacacagcagaggcccacggccacattcaggacgtttcagccaatcaggcgc
tacaccgcgccggtggccgcagagccgtttctgaacggcacgagctcgaactatgtagag
gagatgtactacgcctggctggagaaccccaagagcgtgcacaagtcttgggacattttc
ttcaggaacgctaatgctggggctcccccgggcaccgcctaccagagtcctcctccgctg
ggcatgggcctggccgagctgactcaggcccagtctctggtcggtgctcagcccaacgtg
gagaagttggtggaggaccatctggctgtgcagtcgctcatcagagcttatcagatccgg
ggtcaccatgtcgctcagctggaccctctggggatcatggatgccgatctggactcgtgc
gtccccaccgacattattacgtcttcggataaactcggattctacggattggaggagtcg
gatctggacaaagtgttccgcctgcccaccactaccttcatcgggggcacagagagcgct
ctgcctctgcgggagatcatccgccgcctggagatgtcgtattgccagcacataggagtg
gagttcatgttcattaacgacctggaccagtgccaatggatccgtcagaagtttgagagt
cccggggtcatgcagttcagcctggaggagaaacgcacactgctggcccgcacggtccgc
tccaccaggtttgaagagttcctccagaagaagtggtcctcagagaaacgttttggcctg
gagggctccgacagcctcatccccgccctcaaaaccatcatcgacaaatccagcgagtgc
ggcgtggagaacgtcgtcatgggaatgccgcacagaggacgactgaatgtgctggccaac
gtgatcaggaaggagctggagcagatcttctgccagttcgactccaagctggaggctgca
gatgagggatcaggagacgtgaagtaccacttgggcatgtaccacaggaggataaaccgt
gtgacggacaagaacatcactctgtctctggtggccaacccatctcacctggaagccgtg
aacccggtggtgcagggcaaaaccaaggccgagcagttttactgcggagacaacgggggc
aaccgggtgatgtccattctgctgcacggtgatgccgcgttcgccggccagggcatcgtc
tacgagaccttccatctgagcgacctgccatcttacactacacacggcacagtgcacgtg
gtcgtcaacaaccagattggcttcaccactgatccccgcatggcccgctcctctccgtac
cccaccgatgtggcgcgcgtggtgaacgcgccgatcttccacgttaacgcggacgacccg
gaggccgtcatgtacgtgtgcaacgtcgccgctgaatggcgagccaccttccacaaagac
gtcgtggtcgacctggtgagttatcggcgtaacggccataacgagatggacgagcccatg
ttcacacagccgctgatgtacaagcagatcaagaagcagaagccggtgctgctgaaatac
gcggagaaactcatcgctgagggagtggtcacacgccaggagtatgaggaggagattgcc
aaatacgacaagatctgtgaggaggcttacgctcgctctaaggacgagaaaatcctccac
atcaagcactggctggattccccttggcctggttttttcacactggacggccagcccaaa
agcatgacctgtccttctacaggattgagtgaggaggagctgacgcacatcggtcaggtg
gcgtcatccgtacctgtggaagactttactattcacgggggtctgagtcggatcctgaag
gctcgaggtgagatgatccggaaccggacggtggactgggctctgggagagtacatggcc
ttcggttctcttctcaaagaggggatccacgtgcgtctcagcggccaggacgtggagaga
ggaaccttcagtcaccgtcaccacgtcctccacgatcagaatgtggataagaggacgtgt
atccccatgaaccacatggccccgaaccaggctccctacaccgtgtgcaacagctcgctg
tccgagtacggagtgctgggtttcgagttgggcttcgccatggccagtccgaacgctttg
gttctgtgggaggcccagtttggagacttccacaacacggcccagtgtataatcgaccag
tttatctgtcccggacaggccaagtgggtccgccagaacggcatagtcctgctgctgccg
cacggcatggagggcatgggtcccgagcactcgtcagctcgccccgagcgtttcctgcaa
atgtgcaacgacgatcctgacgttttccctaaaatcacggacgacttcgctgtgcgtcag
ctgtacgactgtaactggatcgtggtgaactgctccactcctgccaacttcttccacgtg
ctgaggaggcaaatcctgcagccgttcaggaagcctctcatcgttttcactcccaaatct
ctgctgcgccacccagaggccaagtccaactttgacctgatgctgcctggcacccatttc
ctgcgtatgatcccagaggaaggtcttgcagcccaggacccagctgcggtgaagcgtctg
atcttctgcacagggaaagttttctacgagctcaagcgcgaacgcaaaacccgtggccag
gagaacaccgtggccatcgcacgcgtcgagcagctctctccattccccttcgacctggtc
aaggccgagacggagaaataccccaacgctgacctggtgtggtgtcaggaggagcataag
aaccagggttactacgactacgtgaagcctcgcatgcgcaccaccatcgaccgctccaag
cccgtctggtatgctggtcgtgaacctgctgctgccccagccaccggcagcaagaactcc
cacctcctggagctgaagcgcttcctggacactgccttcaacctggacgccttcaaagat
cacatctaa

DBGET integrated database retrieval system