KEGG   Ictalurus punctatus (channel catfish): 108267979Help
Entry
108267979         CDS       T04658                                 

Definition
(RefSeq) coagulation factor XIII A chain-like
  KO
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
Enzymes [BR:ipu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108267979
Cell adhesion molecules and their ligands [BR:ipu04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     108267979
   VLA-9
     108267979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
7
AA seq 744 aa AA seqDB search
MTDQETPENTATPITPAVPAVRPKQASHHGRNVGPIANSNKEYEEIPEFEPFMLLPRGPP
PLTEYLDIWDVNMLKQPNEENKQRHHTHLYSNDHLIVRRAQEFLIKITFNRPFKPEQDKF
AVEFAIGAGAQYSKGTYIPVFPTAERQSVWRGQILESSDNVVTMGITPAPDCIVGKYRMH
VAVVTPYGIRRTRRDPSLDTYIIFNPWSPGDTVYLDDEEEREECVLNELGIIYHGAYDDV
SERTWNYGQFEFGILDACLFILDKAEMPLTNRGDPIKISRKGSAMLNSRDDDGVLLGNWS
GDYLYGVAPTSWTGSVEILLDYAGSGGQSVGYAQCWVYAAVFNTFLRSLGIPSRVVTNFF
SAHDNNGNLKMDIILDENGRVDRNHTRDSIWNYHCWNECYMARPDLPDGFGGWQVVDATP
QETSDGMYRCGPASVAAIKHGQVCYPFDAPFVFAEVNSDLVYYSRSKDGTLEPVKVNTSY
VGRMVLTKAVLDKGRRDIINNYKFPEGTAEERRVLEKAEEFGCQREKASVPQADVEVEIL
PLEVQRGDDFHLELQFTNHSSQRRVVDIYISGNVVYYTGVPSAEIIFETPVVKLEPQQSK
KEKVVVRSKDYQSKLVEQGNLNFIATGKVQETGRIITAMRVVTVHNPKLTVQVTGSPRVA
EEMYVTVEFTNPFKFSLENVYVRVEGPGIMSINTKQYSVIGPGSSITWTERFSPRRAGTT
KLMASLDCAALRQVYGEVEVTIQP
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgactgaccaggagactcctgagaataccgccacaccgataacacctgctgtacctgct
gtacgccccaaacaggcgtctcaccatggacgcaatgtgggcccaattgcgaactccaat
aaagaatatgaagagatcccggagtttgagccgttcatgcttctgcctagaggtccacca
cctcttactgagtacctggatatctgggatgtcaatatgctcaaacagcccaatgaggag
aacaagcagaggcatcacacacacctctactccaatgatcacctgatcgtacgccgagcg
caggagttcctcatcaaaatcaccttcaatcgtcctttcaagcctgaacaggacaagttt
gctgttgagtttgcaatcggtgctggtgcacagtacagtaaaggcacctacatacccgtc
ttcccgactgcagagcggcagagtgtgtggcgtggtcagatcttagagagctcagacaat
gttgtcaccatgggcatcactcctgctcccgactgcattgtgggaaagtacaggatgcat
gttgctgtggtcactccatatggcattcggaggactaggagggacccaagcttggataca
tatataatcttcaacccctggtcaccaggtgatactgtataccttgatgatgaagaggag
agagaggagtgtgtgctgaatgaattgggcatcatctatcatggcgcgtacgatgacgtt
tcagagcgtacctggaactatggacagtttgagtttggcattctggatgcatgtctgttc
atcttggataaagctgaaatgcctctcacaaaccgtggagatcctatcaaaatcagcagg
aagggctctgctatgttgaactcacgtgatgatgatggcgtgctgttgggaaactggagt
ggtgattacctgtatggtgtggctcccacctcctggacaggcagtgtggagatcctgcta
gattatgctggaagtgggggacagtcagtcggctatgcccagtgctgggtctatgctgct
gtgtttaatactttcttacgctctctgggtatccctagcagagtggtcactaacttcttc
tctgcccatgacaacaatggaaacctgaaaatggacatcatactagatgaaaatggcaga
gtggacagaaaccacaccagggactccatctggaattatcattgttggaatgagtgctac
atggccagacctgatctccctgatggctttggaggctggcaggttgtggatgctacacct
caggagaccagtgatggtatgtaccggtgtggacctgcatctgtagcagccattaaacat
ggccaggtctgctatccttttgatgccccatttgtgtttgcggaggtgaacagtgacttg
gtgtactactccagaagtaaagatggcacactggaaccagtgaaggtgaacaccagctat
gtgggccgcatggtgctgaccaaagcagtgctggataaaggacggagagacatcatcaac
aattacaaattccccgagggcactgcagaggaacgcagagttctggagaaagccgaggag
tttggctgtcagcgggagaaggcttctgtgcctcaggcagacgtggaggtcgaaatcctt
cctctggaggtgcagcggggtgatgattttcacctggagctgcagttcaccaaccacagc
agtcagcgacgtgtggtggacatctacatcagtggtaatgtggtctactacacaggagtg
ccgagtgctgagatcatcttcgagaccccagttgtgaaactggagccacagcagagtaaa
aaggaaaaagttgtggtgcgcagtaaggactatcagagtaagctggtggaacagggaaac
ctgaacttcattgctacagggaaagtgcaagagacgggtcgaatcataaccgccatgagg
gttgtcactgtgcacaatcccaaactcactgtgcaggtgactggttctcccagagtggct
gaagagatgtatgtgacagtcgagttcaccaacccttttaaattcagtttggaaaatgtg
tatgtgcgtgtggaggggcctggcatcatgtcaatcaatacaaaacagtacagcgtaatc
ggtccaggcagctctataacatggacggagcgtttcagtcctcgaagggcaggaaccacc
aaactgatggccagcctggactgtgctgctctcagacaggtgtatggggaggtggaggtc
accatccaaccataa

DBGET integrated database retrieval system