KEGG   Ictalurus punctatus (channel catfish): 108270869Help
Entry
108270869         CDS       T04658                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  
transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     108270869 (tmprss9)
Peptidases [BR:ipu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   108270869 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
10
AA seq 791 aa AA seqDB search
MKQQQSKWPEGDPPPAPSSTVCRYIILCTILAFLIICTFVGVVMAYTVQKEHYFMDTVEL
KGLQYKADLKDKMSAFFLILTATLETKMQNIFLASSIVPHFVSCRIVAYGNISNNVMATL
YLVFRVAKFQEQFTEYTDRFLQEQIQYGFQALVSPNPLTVPEFGEIQSIVLLGASKKSFY
VINANASRCPDATFTCASGECLTKPNPECDSVSDCADESDEAYCSCGRKLVVDSRVVGGQ
NAGRGDLPWQVSLRLHGRHTCGASIVNRRWLVSAAHCFESSKNPRDWTVLVGANLVSGVE
KGAVTVNIKSLIVSPHYNPMNSDNDVTVLELEKPLIFTPFVQPICIPSSSHVFSPGQDCI
VSGWGAIKQDSSKVPPTLQKASVKIIDSKVCNSSTVYRGAITNNMMCAGFLQGKVDSCQG
DSGGPLVCESSPGRYFLAGIVSWGMGCAQINKPGVYSQVTVLRNWILSHAEPSNSQDRPT
ILSATNTAVLRAKAVTSTPVVTGSNTSTGAVNCSGNFNCGAGLCISKINPECDRVADCSN
EADEKNCDCGQRPEFSQRIVGGVSARRGEWPWVASLQFQRLHRCGATLIHCKWLITAAHC
FSRKESNPSGWTVSLGSVLRSGLGALVIPVQRIIQHPAFNSSNMDFDVALVLLSIPAPSS
YTIQTLCLPSPTHSFFKGTECYITGWGSMREDGKLTNQLQRAQVGIIDQSECQQSYGRKL
TANMMCAGSMEGGIDTCLGDSGGPLACREPRGRWFIAGVTSWGRGCARNRFPGVYTRVTA
IREWISTYLPF
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagcagcagagtaagtggcctgagggtgatcctcctcccgctccatcctccacc
gtgtgcagatacattatactctgcaccatcttggcgtttctcatcatctgtacgtttgtg
ggggttgtgatggcgtacacggtacagaaggagcattacttcatggacacggtggagtta
aaaggcctgcagtacaaagctgacctcaaggataaaatgtctgcattttttttaatcctt
acagccactttggaaacaaagatgcagaatattttccttgcatcgtcgattgtaccccat
tttgtctcctgccgtatcgttgcgtacgggaacatcagtaataacgtgatggcgacactt
tatctggtgttcagagtggccaaatttcaagaacaatttacagagtacacagaccgtttc
ctccaggagcagattcagtacggctttcaggctttagtcagtccgaacccgctgaccgtt
cctgagtttggagaaattcagagcattgtccttcttggtgctagcaaaaagtctttctat
gtaatcaacgctaatgcaagcagatgtcctgatgccacattcacctgtgccagtggggag
tgtttgactaaacctaatcccgagtgtgactccgtgtcggattgtgctgatgaatcagat
gaggcatactgctcgtgtggcaggaagctggtggtggacagtcgggttgttgggggtcaa
aatgccggtcgtggtgatttgccctggcaggtgagtctgagactccacggccgtcacacc
tgcggagcctccatcgtcaaccgccgctggttggtcagcgctgcacactgctttgagagc
agtaaaaacccgagggactggacggtgctggtcggagcgaacttagtgagtggtgtggag
aaaggagcagtcacagtgaacatcaagtctctgattgtctctccacattataaccccatg
aattcggacaatgacgtgaccgtgctggagctggagaagccgctgattttcactcctttc
gtccagcccatctgcatcccatcctcgtctcacgtcttcagtcctggacaagactgcatc
gtctctggttggggagccatcaaacaggacagcagcaaggtgcctcctacactccaaaaa
gcctcggtgaagataattgattcaaaagtgtgtaacagttcgaccgtatacagaggagcc
atcaccaacaacatgatgtgcgctggcttcctgcagggaaaagtcgattcctgccaggga
gactcgggaggtcctctggtgtgtgaaagcagccctggccgctacttcctggcgggtata
gtgagctggggaatgggctgtgcacagatcaataaacctggagtgtattctcaggtcact
gtgctccgcaactggatcctgagccatgctgagcccagtaacagtcaggacagacccacg
attctcagcgcaacaaacactgcagtccttcgtgctaaggccgtcacatcaactcctgtg
gtgactggtagcaataccagtactggagctgtaaactgcagtggaaactttaactgtggt
gcaggattgtgtatcagcaagatcaaccccgagtgtgacagagtggctgactgctctaac
gaagccgatgagaagaactgcgactgtggccagcgacctgaattcagccagagaattgta
ggaggtgtgagtgcccgtcgaggggagtggccatgggtggcaagtctgcagttccagcgt
ttacatcgttgtggtgccacccttatacactgcaaatggctcattacggctgctcactgc
ttcagcagaaaggagtcaaaccccagtggctggacggtgagtttaggctcggtgctccgg
tccggattgggagctttggtcatcccagtgcagaggatcatccagcatcctgccttcaac
agcagcaatatggattttgatgtggctctggtactgctctcgatcccggcaccgagctcc
tacaccatccagacgctgtgtttaccctccccgacacacagcttcttcaagggcacagag
tgttacatcactgggtggggctcaatgagggaggatggaaagttaactaatcagttgcaa
agagctcaggttggtataatagaccaatctgagtgtcagcagtcttacggcagaaaactg
actgccaacatgatgtgtgctggatccatggaaggtggcattgacacctgtctgggagat
tctggaggaccgttagcatgccgcgaaccccggggccggtggttcatagctggggtgacc
agttggggtcgaggctgcgctcgaaacagattccccggggtttacacgcgtgtcactgcc
atcagggaatggatatcaacatacctcccattttaa

DBGET integrated database retrieval system