KEGG   Ictalurus punctatus (channel catfish): 108271649Help
Entry
108271649         CDS       T04658                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
ipu00250  Alanine, aspartate and glutamate metabolism
ipu00410  beta-Alanine metabolism
ipu00430  Taurine and hypotaurine metabolism
ipu00650  Butanoate metabolism
ipu01100  Metabolic pathways
Module
ipu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    108271649
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    108271649
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    108271649
   00430 Taurine and hypotaurine metabolism
    108271649
Enzymes [BR:ipu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     108271649
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 108271649
NCBI-ProteinID: XP_017334844
UniProt: A0A2D0RWG8
LinkDB All DBs
Position
11
AA seq 594 aa AA seqDB search
MMMAASASSSSSSSAVEVDQSSANLRPPASACDGWYGVAHGCTRKLGMKICGFLQKNNSL
EEKGRMMGSFREKEQSHNRENREKETRFTRTETDFSNLFARDLLPAKNGEEPTMQFLLEV
MEILTNYVRKTFDRSTKVLDFHHPHQLLEGIEGFNLELCDQPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIVGWR
NGEGDGLFSPGGAISNMYSVMIARYKYFPEVKTKGMSAAPRLILFTSEHSHYSIAKAGAA
LGFGKENVILLSTDERGRVIPADLEAKIISAKQKGYVPLFVNATAGTTVYGAFDPINDIA
DICEKYNMWLHVDGAWGGSLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVRE
KGILQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFEQHV
DRCLELSEYLYNKIKNREGYQMVMQGEPQHTNVCFWYIPPSLRNIPDGEERRERLHKVAP
KIKAMMMECGTTMVGYQPQGDKVNFFRMVISNHAATKSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgatgatggcggcttcggcttcatcctcctcctcttcctcagccgtcgaagtggatcag
agctctgctaatctgcgacctccagcctcggcatgcgatggctggtacggggtcgcgcac
ggctgcacccgcaaactgggcatgaagatctgcgggtttctgcagaagaacaacagcttg
gaggagaaaggcaggatgatgggatccttcagagagaaagagcagagtcataacagggag
aatcgggagaaggaaacacgcttcacccgcaccgagactgacttctccaacctgttcgcc
cgggatttacttcctgctaaaaatggtgaagagccgactatgcagtttctcctcgaggtc
atggagatcctcaccaattacgtccgcaagaccttcgacagatccaccaaagttctggac
ttccaccatccacaccagctcctggagggcatcgagggcttcaacctggagctctgtgac
cagcctgagtcactcgagcagatcctcgtggactgcagggacacgctcaagtacggggtc
cgcacaggtcacccaagatttttcaatcagctctccactggcctggacatcatcggcctg
gctggagaatggttaacatccactgctaacactaacatgttcacctacgagattgcgcct
gtgtttgtgctgatggagcagctgacgctgaagaagatgagggagattgtcggctggcgt
aacggcgaaggagacggacttttctcaccgggtggtgctatatcaaacatgtacagtgtg
atgatcgcccgctataagtatttccccgaggtcaaaaccaaaggcatgtcggctgcaccg
cgcctcattctctttacatcagaacacagtcactattcgatcgccaaagctggagcggcc
ctgggtttcggtaaagaaaacgtcatcctgctcagtaccgatgaaaggggtcgggtcata
cctgcagacctggaggctaaaatcatcagcgccaaacagaagggttatgttccactcttt
gtgaacgcgacagccggtactacagtgtacggagcgtttgaccccatcaacgacatcgca
gacatctgcgagaaatacaacatgtggctccatgtggacggtgcatggggtggcagtctg
ctgatgtcaaggaagcatcgtcacaagctgaacggcgtcgagagagcgaactcggtcacg
tggaacccacacaagatgatgggagtgccactgcagtgttcagccatcctggtcagagag
aagggaattctgcagggctgtaactccatgtgtgcaggttacctgttccagcctgataaa
cagtacgatgtgacgtatgatacgggagataaagccatccagtgtggcagacacgtggac
atcttcaaattctggctcatgtggaaggccaagggaacagttggatttgagcagcatgtc
gaccggtgtctggagctctctgagtatctctacaacaagatcaagaatcgcgagggttac
cagatggtcatgcaaggagagccccagcacaccaacgtgtgtttctggtacattccaccc
agtttgaggaacatcccagacggagaggagagaagggaacgactgcacaaggtggcgcca
aagatcaaagcgatgatgatggagtgcggcaccaccatggtgggctaccagccgcaggga
gacaaagtcaatttcttccgcatggtcatctccaaccacgctgccaccaagtcggacatc
gacttcctcatcgaggagatcgagagactcggacaagacctgtga

DBGET integrated database retrieval system