KEGG   Ictalurus punctatus (channel catfish): 108271939Help
Entry
108271939         CDS       T04658                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
Enzymes [BR:ipu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108271939
Cell adhesion molecules and their ligands [BR:ipu04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     108271939
   VLA-5
     108271939
   VLA-9
     108271939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
11
AA seq 678 aa AA seqDB search
MALDIGTWDLECEFNNTTHRTELNGTDRLIVRRGQPFTIKLNLRSGSYEPGVHQLHITAE
TGPEPVEQYGTKAVFGLSDDIDDTQWSAAVTSPPGDIVALSICSAPDAPIGHYTVTLDGR
IQFKFILLFNPWCPRDAVYMNNEENLEEYVLAQDGIIYRGDAKYLIPSAWYFGQFEEGIL
DVCLRILDVNPKYQRNPGKDCSGRRNPIYVSRVLSAMVNSNDRDNGVLEGCWKQTFDGGI
SPMSWRGSVEILKTWNSTSCLPVRYGQCWVFAAVACTVSRALGIPCRVVTNYLSAHDTNS
NLVIERYVDENGKLLNTTRDMIWNYHCWLESWMARPDLKAGFDGWQASDPTPQEKSEGVF
CCGPVSVKSIKEGELLFKYDAPFVFSEVNADVETFLKYKDGSTRKIISTTEVGQKISTKS
VGSDKREDITHLYKYPEGTAEEREAFKKANHQSKLLKEPNNSGLHVTIKIGTDLRKGCDF
DVFALVTNQTSVLKKCRLVFASRAMSYDGTIGQECGFKDLLNVELQPGGERKVQLRLNYS
KYCNAITQDNLIRLGALLIDYSTREGILAMRTIVLENPEIGIKILGEPKENRKLAAELTV
RNTLPEPLSACCFSIEGANLTGGKTITESVSTSIEPGQEAKIKIYFTPTHYGLRKLLVDF
NSDKLGPVKGFRNVIIGK
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgacattggcacttgggaccttgaatgtgagttcaataacacaacccaccgc
acagagctgaatggcaccgatcgcctgatagtgaggagaggacagccattcaccatcaag
ctcaaccttcgctctggctcctacgagcctggagtccatcagctccacatcacagcagag
acagggccagaacctgtggagcagtatggtaccaaggctgtttttggtctgagtgatgat
attgatgatacacagtggagcgctgcagtaaccagtccccctggggacattgtcgccttg
tccatctgttctgcccctgatgcaccaatcggccactacactgtgactctggatggcagg
attcagtttaaattcatactgttgttcaacccctggtgcccccgagatgcggtgtacatg
aacaatgaggagaacttggaagaatatgttttggctcaggatgggatcatctacaggggt
gatgccaaatatctcatcccttcagcatggtactttggccagtttgaagaaggcattctg
gatgtgtgtctaagaattctggatgtgaacccgaaataccagaggaaccctgggaaagat
tgttctggtcgcagaaaccctatttatgtctctcgagtgctaagtgctatggtgaacagt
aatgaccgagataatggggtattggaaggctgctggaagcaaacgtttgacggtggaatc
agtcctatgtcatggagagggagcgtggagattctcaagacttggaactccacttcttgc
ctgcctgtccgctacggccagtgctgggtgtttgctgcagttgcctgcactgtgtctcga
gcattgggtatcccctgcagagtggtgactaactacctctcagcccatgacaccaacagc
aacctggtgattgaacgctatgtggatgaaaatggcaagctgctgaacaccacaagagac
atgatctggaactatcattgttggctggagagctggatggctcgtcctgatctgaaagca
ggctttgatggctggcaggccagtgaccctacaccccaggagaagagcgagggggtgttc
tgctgtggaccagtctcagtgaaatccataaaggaaggagaactcctttttaagtatgat
gctccgtttgtgttctcggaggtaaatgcagatgtggagaccttcttaaagtacaaagac
ggcagcacaagaaagatcatcagtactactgaggttggccagaaaatcagcactaagagt
gttggaagtgacaagcgagaggacattacacacctttacaagtacccagaaggcactgct
gaggaacgagaggcatttaaaaaagccaatcatcaaagcaaacttttgaaagagccaaac
aactccggcctccatgtcaccattaagatcggtacagatttgaggaagggctgtgacttt
gatgtctttgccttggttaccaaccagacatcagtgttaaagaagtgtcgtctggtgttc
gcttcccgtgccatgtcttatgatggaactattgggcaggaatgtggcttcaaagacctg
ctcaatgttgagttacaacctggaggagagcggaaggtccaactgaggctgaactacagt
aaatactgcaatgcaataacccaggacaacttgatccgcctgggtgctctactgatagac
tacagcaccagagaaggcattctggctatgcgcactattgtccttgaaaacccagagatc
gggataaagatcctgggagaacccaaagagaaccgtaagctggctgcagaactcactgtg
cggaacactctgccagagcctttaagtgcatgctgcttcagcattgagggagccaatctc
actggaggcaagaccattactgagagtgtttcaaccagtattgaacctggacaagaagcc
aagatcaaaatctacttcacacctacccattatggcttgcgcaaactgctggtggatttt
aacagcgacaaacttggtcccgtaaaagggttcaggaatgttattattggcaaataa

DBGET integrated database retrieval system