KEGG   Ictalurus punctatus (channel catfish): 108280800Help
Entry
108280800         CDS       T04658                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
Enzymes [BR:ipu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     108280800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
20
AA seq 777 aa AA seqDB search
MSVRDGSAVGRFHGAAASNGQAIPEKEVVTKETRQEGGCRRWFRKVCPCCCRRQNNSYDI
TNELDTMVKDEEKVTPFSEPPQPHTGDNELEDLSLVVLSMDLLSSKTGQNRKEHHTEQYY
GNELIIRRGQTFQIMLDLSRHFNINTDKLHLELKTGPLPLVSKGTHIIVPLVEELQDLCW
EAKIVEQNANRIKLSINSPPTAVIGKYKLTVSTRSTESERVNVYDPEKDVYMLFNPWCED
DQVYMDDDAEKKEYVLNDTGKIYYGTEKQIGARTWNFGQFQEGILEACLYVLEKSEVPPS
GHRDPVNVVRVISAMINSPDDHGVLEGNWSGNYLGGTSPTAWSGSVDILKKYHKEEGVPV
KYGQCWVFSGVTTTVLRCLGIPTRSVTNFQSAHDTDVSLTTDVYFDENMEPINSLNSDSV
WNFHVWNDCWMARPDLPPGMGGWQAVDSTPQETSQGTFRCGPASIMAIRTGQVYLKHDTP
FVFAEVNSDKIYWQRNLDGTFSQIHIEKNAVGRCISTKAVGSDQRSDITHLYKHPEGSEE
ERITVETACRYGTKPDVYASAAKNDVCMEVRVEGEGPRMGTDAHLRIILKNQSEQPRKTT
LHSQVAVMYYTGVLKDTVKTEKLPVHLMPNEEKVIDWVLPYQHYQNQLVDQAALMLTLSG
RVNETMQVLASQTSFRLRTPDIHIEPLGEAYVGKGATAKLTFTNPLPCTLHNVVLRVEGL
GLRNLHPIKVGDVSKHATVTVTEHFIPSVAGTRKLVASLDCKQLSQVHGVADIIVHE
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtcagagacggttcagctgtcggccgcttccatggcgctgccgccagcaacgga
caagcaatacctgagaaggaggtggttactaaggaaacgaggcaggagggaggctgtcgt
cgctggttccggaaagtttgcccctgttgctgtcgcagacagaacaactcctatgatatt
acgaatgaactggacaccatggtcaaggatgaagagaaagtgacaccattttccgagcct
cctcaacctcacacaggagacaacgagctggaagatctgtctctggtcgtactctccatg
gacctgctcagctcaaagactggccaaaatcgtaaggagcaccataccgagcagtactac
ggcaatgagctcatcatccgccgaggccagacctttcagattatgctcgacctttcccgc
catttcaacatcaacacggacaagctgcatctggaactgaagacaggcccactgccgctg
gtgtcgaagggcacgcacatcatcgttcctctcgtggaggagctgcaggacctgtgctgg
gaagccaagattgtggagcagaacgccaatcgcatcaagctgtcaatcaactctcctccc
acggctgtcatcggaaaatacaagctcacagtcagcacccggagtacagaaagcgagcgt
gttaacgtctatgaccccgagaaagatgtctacatgctcttcaacccctggtgtgaagac
gaccaagtgtatatggacgacgatgctgagaaaaaggagtatgtgctgaacgacactggg
aaaatttactacggcacagagaagcagatcggcgctcgcacgtggaactttggacagttt
caggaagggattctcgaggcctgtttgtatgtgctggagaagagcgaagttcctccatca
ggtcatagagatccagtgaacgtggtgcgagtcatatccgccatgatcaattctccagat
gaccatggagttctggaaggaaactggtcagggaactatctaggtgggacgtctcctacg
gcatggagtggcagcgtggacattctcaagaagtatcacaaagaagaaggtgttcctgtt
aaatacggccagtgctgggtcttctccggggtgaccaccacagttctgaggtgtcttggt
atcccaactcggagcgtaacaaatttccagtccgcccacgacactgatgtctccttgacc
actgatgtgtattttgacgagaatatggagccaattaactccctcaactccgattccgtg
tggaacttccatgtgtggaacgactgctggatggctcgtcctgatttgccacccggtatg
ggaggctggcaggctgttgactcgaccccccaggaaaccagtcaggggacgttccgctgt
ggccccgcctccatcatggcaatccgcacgggccaggtttacttgaagcacgacacacct
tttgtcttcgctgaggtgaacagcgataagatctactggcagaggaacctggatggcact
ttctctcagattcacatagagaagaacgctgtgggacgctgcattagcaccaaggctgtt
ggctctgatcagcgtagtgacatcacacacctgtacaaacatcctgaaggctctgaagaa
gagcgtatcaccgtagagacggcctgccgctatggcaccaagccagacgtgtacgcatcg
gcagcaaagaatgacgtgtgtatggaggtgcgggtggaaggtgaggggccgcgcatgggc
accgatgcccacctcaggataattttgaagaaccagagcgaacagcctcgcaagaccacg
ctgcacagccaggtggctgtgatgtactacacaggtgtgctgaaggacacggtgaagact
gagaaacttcccgtgcatctcatgccaaatgaagaaaaagttatagactgggtgctgccc
taccagcattatcagaaccagctggtggaccaggcggcgctgatgctcactctgtccggt
cgagttaacgaaaccatgcaggtgctggcttctcagaccagcttcaggctgcgcacgcca
gacatccacatagagcctcttggagaggcctatgtagggaagggggccacggccaagctg
actttcaccaacccgttaccatgcaccctgcacaacgtggtactgcgagtggaaggtctc
ggactcaggaacctccatcccatcaaagtcggcgatgtgagcaagcatgccacggtgacg
gtgacggagcacttcatcccctctgtcgccgggacgaggaagttggtggcttctctggac
tgtaaacagctctcacaggtgcacggcgtcgccgatatcatcgtacacgagtga

DBGET integrated database retrieval system