KEGG   Ixodes scapularis (black-legged tick): IscW_ISCW003730Help
Entry
IscW_ISCW003730   CDS       T01131                                 

Definition
(RefSeq) galactosyltransferase, putative
  KO
K07819  
beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
isc  Ixodes scapularis (black-legged tick)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:isc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    IscW_ISCW003730
Enzymes [BR:isc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     IscW_ISCW003730
Glycosyltransferases [BR:isc01003]
 Glycan extension
  Type 1 chain
   IscW_ISCW003730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
LinkDB All DBs
AA seq 316 aa AA seqDB search
MATALVRLLPRITVIALCLLFGYGLLYRPLSFGSLAGRPRPDMSWLLAQQDIRQLISNGS
LLLSPKDPCPSFLAVVICSAVNNFVARRAIRDTWGQDARSPLVRAFFLLGRTDNETLQED
VVRESRLFGDVIQADFMDTYNNLTVKSVVLLKWTGQQCPQTRYILKTDDDMYVNVPNLVS
YLNKKGGRKMLLGCLISGATPIRDWTSKWYVPPFVYPHHTYPDYLSGTGYVMSGDVLGQL
FRTALETPFFYMEDIFVTGMVAQKVGIKPVNYDAFKFYKRKNNPCVFRKLITAHIMTPSE
LRSMWSRVRDRRIKCS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagccctggtgcgcctgctgccccggatcactgtcatcgctctgtgcctcctg
ttcggctacggactgctgtaccggccgcttagcttcggtagcctcgcgggcaggccccgc
ccggacatgtcctggctcctggcgcagcaggacatccgccagctcatctcgaacgggtcg
ctgctcctcagccccaaggacccgtgcccttccttcttggcggtcgtcatctgttcggcc
gtgaacaacttcgtggccagaagggccatccgcgacacctggggacaggacgcgaggtcg
cctctggtccgcgccttctttctgctgggacgcaccgacaatgagaccctgcaggaagac
gtggtccgcgaaagcaggctcttcggcgacgtcattcaggcagacttcatggacacctac
aacaacctgacggtcaagtccgtggtgctgctcaagtggaccggccagcagtgtccccag
acgaggtacatcctcaagacggacgacgacatgtacgtgaacgtgcccaacctcgtttcg
tatcttaacaagaagggcggccgcaagatgctcctgggttgcctcatcagcggcgcgact
cccatccgcgactggacgtccaagtggtacgtgccgccgttcgtgtacccgcatcacacg
tacccggactacctttccggcacggggtacgtgatgtccggggacgtgttgggacagctg
ttcaggacagcgctggagactcctttcttctacatggaggacatcttcgtcaccggcatg
gtggcgcagaaggtgggcatcaagcccgtcaattacgacgccttcaagttttacaagcgg
aagaacaacccgtgcgtgtttcggaaactcatcacggcgcacatcatgactccttcggaa
ctgaggagcatgtggagcagagtgcgtgatcggaggatcaagtgctcctga

DBGET integrated database retrieval system