KEGG   Isoptericola variabilis: Isova_0706Help
Entry
Isova_0706        CDS       T01520                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
iva  Isoptericola variabilis
Pathway
iva00473  D-Alanine metabolism
iva01100  Metabolic pathways
iva01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Isova_0706
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Isova_0706
Enzymes [BR:iva01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Isova_0706
Peptidoglycan biosynthesis and degradation proteins [BR:iva01011]
 Precursor biosynthesis
  Racemase
   Isova_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEG43492
JGI: Isova_0706
UniProt: F6FWS0
LinkDB All DBs
Position
748517..749746
Genome map
AA seq 409 aa AA seqDB search
MRESLTVSSSDLAPGAPARAVVDLDAIRDNVRALRDHAPSSDLMAVVKADGYGHGMVPAA
RAALAGGATWLGVATAHEALALRASGVTGDARVLVWLLVPGAPFADLVRADVDVTVAAPW
SVDEVAAGAREAGRPARVHLKVDTGLSRNGVTPADLPGVVRRLATLEASGEVRVVGVFSH
LACADEPGHPSVARQAAAFDDAARAVAAAGLRPEVRHLANSAATLTAPEVHHDLVRPGIA
VYGLSPVPQLGPPGAYGLRPAMTLEARLGNVKAVPAGEGVSYGHLYTTPRDTVLGLVPLG
YADGIPRHASGGSAGVGGPVAVGSGDARRVLRIAGRVCMDQVVLDLGPDATERPGDVATL
FGASEGVAHGATVPNAQDWAEAAGTISYEIVTRIGARVPRTYAGKDVQP
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgagagaatcgctgaccgtgagcagctccgacctggcgcccggcgccccggcgcgcgcc
gtcgtcgacctcgacgcgatccgcgacaacgtgcgcgcgctgcgcgaccacgcgccgtcg
tcggacctcatggccgtcgtcaaggccgacgggtacgggcacggcatggtgcccgctgcg
cgcgcggcgctcgcgggcggcgccacctggctcggcgtcgcgacggcgcacgaggcgctc
gccctgcgtgcctccggggtcacgggcgacgcgcgggtgctcgtctggctgctcgtcccc
ggcgcgccgttcgccgacctggtgcgtgccgacgtcgacgtgaccgtcgccgcgccgtgg
tcggtcgacgaggtcgccgccggcgcgcgcgaggccgggcgccccgcgcgggtacacctc
aaggtcgacacggggctgagccgcaacggcgtcacgcccgccgacctgcccggcgtcgtg
cgccggctcgcgaccctcgaggcctcgggcgaggtgcgcgtcgtcggcgtcttctcccac
ctcgcgtgcgcggacgagccgggccacccgtcggtcgcgcggcaggccgcggcgttcgac
gacgcggcgcgtgcggtcgcggccgccgggctgcggcccgaggtgcgccacctcgccaac
tcggcggcgaccctcaccgcgcccgaggtgcaccacgacctggtgcggcccggcatcgcc
gtctacggactgtcgccggtgccgcagctcggtccgcccggggcgtacggcctgcgaccg
gccatgacgctcgaggcgcgcctcgggaacgtcaaggcggtccccgcgggcgagggcgtc
tcctacggtcacctgtacacgacgccgcgcgacacggtgctcgggctcgtcccgctcggg
tacgccgacgggatcccccggcacgcgtcgggcgggtcggccggcgtgggcggcccggtc
gccgtcggcagcggcgacgcgcgtcgcgtgctgcgcatcgcggggcgggtgtgcatggac
caggtcgtgctcgacctcggccccgacgcgaccgagcgcccgggcgacgtcgcgacgctg
ttcggcgcgtccgagggcgtcgcgcacggggccaccgtgccgaacgcccaggactgggcc
gaggccgccggaaccatcagctacgagatcgtgacgcggatcggtgcgcgcgtgccgcgc
acctacgcggggaaggacgtgcaaccgtga

DBGET integrated database retrieval system