KEGG   Janthinobacterium sp. LM6: BZG29_16665Help
Entry
BZG29_16665       CDS       T04756                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
jal  Janthinobacterium sp. LM6
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:jal00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZG29_16665
  Energy metabolism
   00680 Methane metabolism
    BZG29_16665
Enzymes [BR:jal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BZG29_16665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3794486..3797233)
Genome map
AA seq 915 aa AA seqDB search
MNEVKDELLSSDIRQLGRLLGDAIRNHLGDPAFERIEHVRQLAIRFRRDNDEAARAQLSD
ALQALSQEETTQLTRAFSYFSLLANIAEDQHHIRRTRAHLIAGSPPRQGSLSHAVGNVFD
AGKADALETFFDDAFVSPVFTAHPTEVQRKSIQNCQMAIARLLSERDRVQMTPEEAEQNE
EALGRGIVTLWQTRLLRTSKLSVMDEVANGLSFYDHTILRELPKLYSSLETMLAQRDARW
EDAELPNFMKVGSWIGGDRDGNPFVTADILRSTLQTQADKVLDFYLGELRKLASQLSLAQ
ILNACSEPLRALAERSADASPHRVDEPYRRALHGIHARLESTRVVLSGKGKQADGVQPYA
TAAELLTDLDVVQHSLVSNGLRALARGRLRQLRRAVKVFGFSLAPLDLRQNSDVHERVVG
ELFAGAQPGLVYLDLDEEQRIAVLLAELESPRLLASPYAQYSEETTSELDIFRAVRAAHV
KYGKESVPNCIISKAASVSDLLEVALLLKEVGLLRQDSREVDVNIIPLFETIDDLRAGPA
IMARAFGLPFYRGLLKSRADQQEVMLGYSDSNKDGGFLTSGWELYKAEIELVTVFKQYQI
KLRLFHGRGGSVGRGGGPSYEAILAQPAGAVQGQIRLTEQGEVITAKYANPEVGRRNLEV
LVAATIQSTLLPQAQLQPKASAGAGHLAAMEELSGTALNAYRDLVYGTEGFEQYFWESTV
IAEIAALNIGSRPASRKKSTSIEDLRAIPWVLSWAQCRLMLPGWFGFGSAVQAYLAAHPA
DGADVLRGMYTDWPFFTSLLSNMDMVLAKSDIAIAGKYAELVKDKTLREAIFTRIRAEYA
ATLDALKLITGQEELQQANPLMQRSIRNRFPYIDPLNHVQVELLKRFREGKQDAAARTGI
HLSINGIAAGLRNSG
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagtgaaagacgagctgctgagcagcgatatccgccagctgggccgtctgctg
ggcgacgccatccgcaaccacctgggcgaccccgccttcgagcgcatcgaacatgtgcgc
cagctggccatccgtttccgccgcgacaatgatgaagcggcgcgcgcgcagctgtccgat
gcgctgcaagcgctgtcgcaggaagaaaccacgcaattgacgcgcgctttcagctatttc
tcgctgctggccaatattgcggaagatcaacatcacatccgccgcacgcgcgcccatctg
atcgccggttcgccgccgcgccagggtagcctcagccatgccgtcggcaatgtgtttgac
gcaggcaaggccgatgcgctggaaacgttcttcgacgatgcgtttgtcagccccgtcttc
acggcgcatccgacggaagtgcagcgcaagagcatccagaattgccagatggctatcgcc
cgcctgttgagcgagcgcgaccgcgtgcaaatgacgccggaagaggcggaacagaacgaa
gaagcgctgggccgcggcatcgtcaccttgtggcagacgcgtttgttgcgcacgagcaag
ttgtccgtcatggatgaagtggccaatggcctgtcgttctacgaccacacgattttgcgc
gaattgccgaaattgtattcctcgctggaaaccatgctggcccagcgcgatgcccgctgg
gaagatgcggaattgcccaatttcatgaaggtcggcagctggatcggcggcgaccgcgac
ggcaaccccttcgtcacggccgacatcctgcgcagcaccctgcagacgcaagcggacaag
gtgctcgacttttacctcggtgaattgcgcaagctcgcttcgcaactgtcgctggcgcaa
atcctcaatgcctgcagcgagccgctgcgcgcgctggccgagcgttcggccgacgcgtcg
ccgcaccgcgtcgacgagccgtaccgccgcgccctgcatggcattcatgcgcgcctggaa
agcacgcgcgtcgtgctatccggcaagggcaagcaggcagacggcgtgcagccctacgcg
actgccgccgaactgctgaccgacctggacgtggtccagcattcgctcgtcagcaacggc
ttgcgcgcgctggcgcgtggccggctgcgccagctgcgccgcgccgtcaaggtgttcggt
ttttcgctggcaccgctcgatctgcgccagaattccgacgtgcacgagcgcgtcgtgggc
gaactgttcgccggcgcccagcctggcctggtctacctggatctcgatgaagagcagcgc
atcgccgtgctgctggccgagctggagtcgccgcgcctgctggcgtcgccgtatgcgcag
tactcggaagaaacaacgtccgaactcgacatcttccgcgccgtgcgcgcagcccatgtc
aaatatggtaaggaatcggtgccgaactgcatcatctccaaggcggccagcgtctcggac
ttgctggaagtggccttgctgctgaaggaagtgggcttgctgcgccaggacagccgcgaa
gtggacgtcaacatcatccccctgtttgaaaccatcgacgacttgcgcgccggccccgcc
atcatggcgcgcgccttcggcttgccgttctaccgtggcttgctcaaatcgcgcgcggac
cagcaggaagtcatgctcggctattccgacagcaacaaggacggcggcttcttgacctcc
ggctgggaactttacaaggccgagatcgagctggtgacggtcttcaagcaataccagatc
aagctgcgcttgttccacggccgcggcggctccgtgggacgcggcggcggccccagctac
gaagccatcctggcccagccggccggcgccgtgcagggacagatccgcctgacggagcag
ggcgaagtcatcacggccaaatatgcgaacccggaagtcgggcgccgcaacctggaagtg
ctggtggccgccaccatccagtcgaccctgctgccgcaggcgcagctgcagccgaaggct
tcggccggcgcgggccatctggccgccatggaagagctgtccggcacggccctgaacgcc
taccgcgacctcgtgtacggcacggaaggcttcgaacaatacttctgggaatcgacggtg
atcgccgaaattgccgcactgaacatcggcagccgtcccgcctcgcgcaagaaatcgacc
tcgatcgaggatttgcgcgccattccctgggtcttgagctgggcgcaatgccgtttgatg
ctgccaggctggttcggtttcggttccgctgtgcaagcctacctggctgcccatcccgcc
gacggcgcggacgtgctgcgcggcatgtacacggactggccattcttcacgtcattgctg
tcgaacatggatatggtgctggccaagagcgacatcgccatcgccggcaagtatgcggaa
ctcgtcaaggataaaaccttgcgcgaggccatctttacgcgcatccgcgccgaatacgcg
gccaccctggacgccttgaagctgatcacgggccaggaagagttgcagcaagccaatccg
ctgatgcagcgctcgatacgcaaccgtttcccgtatatcgacccgctcaaccacgtgcag
gtggagctgttgaaacgtttccgcgagggtaaacaggatgcggcggcgcgcacgggcatt
catttgtcgatcaatgggattgcggctggcctgcgcaatagcggttaa

DBGET integrated database retrieval system