KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_00615Help
Entry
YQ44_00615        CDS       T04539                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:jaz00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    YQ44_00615
Enzymes [BR:jaz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     YQ44_00615
Transporters [BR:jaz02000]
 Other Transporters
  Pores ion channels [TC:1]
   YQ44_00615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
142882..143553
Genome map
AA seq 223 aa AA seqDB search
MIVVHHLNNSRSQRVLWLLEELGLDYEVKRYQRDPKTMLAPAALKAVHPLGKSPVITDGA
NTIAESGAIIDYLLERYGNGRLVPAAGTPEKLRWTYWLHFAEGSAMPPLLMKLVFDKVES
SPMPFFVKPIARGIASKVRDSFIMPNINSQLAYMEAELEKTKWFAGNEFTAADIQMSFPL
EAAASRGGLDARLPKLTAFLQRIHARPAFQRALEKGGPYDFAK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtccaccatctgaacaattcgcgctcgcagcgcgtgctctggctgctcgag
gaactggggctcgattacgaggtcaagcgctaccagcgcgacccgaaaaccatgctggcg
cccgccgcgctgaaggctgtgcatccgctgggcaagtcgcccgtgatcacggacggcgcc
aacaccatcgccgaatcgggcgccatcatcgactacctgctcgagcgctacggcaatggc
cgcctggtgccggcggcgggcacgccggaaaagctgcgctggacctactggctgcatttc
gcggaaggctcggccatgccgccgctgctgatgaagctggtgttcgacaaggtcgaatcg
tcgcccatgcccttcttcgtgaaaccgatcgcgcgcggcatcgccagcaaggtcagggac
agtttcatcatgccgaacatcaacagccagctcgcctacatggaagcggagctggagaaa
accaaatggtttgccggcaatgaattcacggccgccgacatccagatgagttttcccctg
gaagcggccgcctcgcgcggcggcctcgatgcgcgcctgccgaagctgacggccttcctg
cagcgcatccatgcgcggcccgccttccagcgcgcgctggaaaaaggcgggccttacgac
tttgcaaagtga

DBGET integrated database retrieval system