KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_19390Help
Entry
YQ44_19390        CDS       T04539                                 

Definition
(GenBank) hypothetical protein
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4504522..4506180)
Genome map
AA seq 552 aa AA seqDB search
MKTFPEILLQRAQSSPDGTAYRFFQGASLVPDVLTFQRVWEESAALAALLQSRGLAGERV
LLTCKSQRHFVIAFFACLMAGAVAVPTALPRRHALLERLQVLSRDAAFRALICDSDEVAP
AHFHDAQAVSDCIDMRTWSACDDLAAMAASWTLPALSGNDLAFLQYTSGSTGDPKGVMVS
HGNLVNNCLAIGQGMQLDAGSSVFTALPLFHDMGLIGGILQSMYTGCSASCMLPAEFVQY
PERWLQIISRFGMTTSGGPNFMYQLAAQSIRDEDMAGLDLSAWSVAFCGAEPIRPEAIDA
FIRRFASVGFRPEAFYACYGMAESTLFITGAQRGAGLEVQQRDESAIVGCGHPRHDTHIA
IVDPDSRQRLADGLVGEIWVQGSSVALGYWRRAELSEQYFHASIADEGAQRYLRTGDLGY
VSNGQLFVSGRLKDLIIHYGKKYLPQDIENEAERNHIALRESGGGAFSIVDGDKQRTVLV
FELKREWLRRHAEWPEVAASVRSAVTANLGLTLDEVLFIKPGALPRTSSGKVRRNQCRLD
YLDGALARAEAP
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacctttccggaaatcctgctgcagcgtgcgcagtcctcgcccgacggcacggca
taccgcttcttccagggcgccagcctggtccccgatgtcctgacattccagcgcgtgtgg
gaagagtccgcggcattggcggccctgctgcaatcgcggggactggccggcgagcgcgtg
ctgctgacctgcaagtcgcagcggcattttgtgatcgccttcttcgcctgcctgatggcg
ggcgccgtcgccgtaccgacggccttgccgcgccgccatgccttgctcgaacggctgcag
gtgttgtcacgcgatgccgccttccgcgccctgatctgcgacagcgacgaagtggcgccg
gcgcatttccacgatgcccaggcggtcagcgactgcatcgacatgcgcacctggtccgcg
tgtgacgacttggcggccatggccgccagctggacattgcctgcgctgtccggcaatgac
ctggctttcctgcaatacacgtccggctccacgggcgaccccaagggcgtgatggtcagc
catggcaacctggtcaacaactgcctggccatcggccagggcatgcagctcgatgccggc
tccagcgtgtttacggcgctgcccctgttccacgatatgggcttgatcggcggcatcctg
caatcgatgtacaccggttgcagcgccagctgcatgctgccggccgaattcgtccagtat
ccggagcgctggctgcagatcatttcgcgctttggcatgacgaccagcggcggccccaat
ttcatgtaccagctggccgcgcaaagcatccgcgacgaagacatggccggcctggatttg
tcggcctggtccgtggcgttctgcggcgccgagccgatccgtcccgaggccatcgacgcc
ttcatccgcaggttcgcctccgtgggcttccgtcccgaggccttctatgcctgctacggc
atggccgagtccaccctgttcatcacgggagcgcaacgcggcgccgggctggaagtgcag
cagcgcgacgagagcgccatcgtgggctgcggccatccgcgccacgacacgcacatcgcc
attgtcgaccccgatagccgccagcgcctggccgatggcctggtgggcgagatctgggtg
cagggatcgagcgtcgcgctgggctactggcggcgcgccgaactgagcgaacagtatttc
cacgccagcatcgcggacgagggcgcgcagcgctacctgcgcaccggtgacctgggctat
gtcagcaacggccagctcttcgtcagcggccgcctgaaggacttgatcatccactatggc
aaaaaatacctgccgcaagacatcgagaacgaagccgaacgcaatcacatcgccttgcgc
gaatccgggggcggcgccttcagcatcgtcgatggcgacaagcagcgcaccgtgctggtg
ttcgaactgaagcgcgagtggctgcgccgccatgccgagtggccggaggttgccgccagc
gtgcgctccgccgtgacggcgaacctgggcctgacgctcgacgaggtgctgttcatcaag
cctggcgcgctgccccggacttcgagcggcaaggtccggcgcaaccagtgccggctcgat
tatctcgatggcgcgctggcgcgtgccgaagctccctga

DBGET integrated database retrieval system