KEGG   Janthinobacterium sp. 1_2014MBL_MicDiv: YQ44_25880Help
Entry
YQ44_25880        CDS       T04539                                 

Definition
(GenBank) aldose epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
jaz  Janthinobacterium sp. 1_2014MBL_MicDiv
Pathway
jaz00010  Glycolysis / Gluconeogenesis
jaz00052  Galactose metabolism
jaz01100  Metabolic pathways
jaz01110  Biosynthesis of secondary metabolites
jaz01120  Microbial metabolism in diverse environments
jaz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:jaz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YQ44_25880
   00052 Galactose metabolism
    YQ44_25880
Enzymes [BR:jaz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     YQ44_25880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DUF2961
Motif
Other DBs
NCBI-ProteinID: APA70669
UniProt: A0A1I9Y3S7
LinkDB All DBs
Position
complement(5960847..5961929)
Genome map
AA seq 360 aa AA seqDB search
MTSVAPVSASATVTEAPFGVLPDGQHVSVLTLTNRQGMQVKVLDFGAIISEIHVPDRNGT
FADVVLGFERIEPYLHNSAFLGAVIGRFGNRIAEGRFHLDGRDFQLAVNNAPNHLHGGNQ
GLHQVMWQAVPFTKDDAVGVTFTRSSPDGEDGYPGRLDVTVVYELDNDNALSLRYHAVTD
QATPVNLTNHSYFNLAGQGHILGHEVTINAERYLPVDAGSIPTGELADVACTPFDLRQPV
VIGNNIDLPHEQIRIGRGFDHNFVLNQKAGQLLNLAATVRDPASGRVMQVYTQEPGIQFY
SGNFLDSSQYGKLRAISYRSALCLETQHFPDSPNQAHFPSTILRPGEEYRTETVYRFSAE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgtcgcacctgtttccgcgtccgccaccgtcaccgaggcgccgttcggcgtc
ttgcccgatggccagcacgttagcgtcttgaccctgacgaaccgccagggcatgcaagtc
aaggtgctcgactttggcgccatcatcagcgaaatccacgtgccggaccgcaacggcacc
tttgccgacgtggtgctcggtttcgagcgcatcgaaccgtatctgcacaacagcgccttc
ctgggcgccgtcatcgggcgcttcggcaaccgcatcgccgaggggcgcttccacctcgac
ggccgcgacttccagctggctgtcaacaatgcgcccaatcacttgcatggcggaaatcag
ggcttgcaccaggtcatgtggcaggccgtgccattcacgaaggacgatgcggtgggcgtc
acgttcacccgcagcagcccggatggcgaggacggctacccgggccggctcgacgtcacc
gtcgtgtacgaactggacaacgacaacgcgctgagcctgcgctaccacgccgtgacggac
caggccacgcccgtcaacttgaccaaccacagctatttcaacctggcggggcaggggcat
atcctcggccacgaagtgacgatcaacgcggagcgctacctgcccgtggatgcgggttcg
attcccacgggcgagctggcggacgtggcctgcacgccgttcgacctgcgccagcctgtg
gtcattggcaacaatatcgatctgccgcacgagcagatccgcatcggccgcggctttgac
cataactttgtgctcaatcaaaaggcaggccaactgctgaacctggccgccaccgtgcgc
gaccctgcttcgggccgggtgatgcaggtgtacacgcaggaaccgggcatccagttctat
tcgggcaatttcctcgacagcagccagtacggcaagctgcgcgccatcagctaccgcagc
gcgctgtgcctggaaacccagcatttcccggactcgccgaaccaggcgcatttccccagc
accatcctgcgcccgggcgaggaataccggacggaaaccgtgtaccgcttttccgccgag
taa

DBGET integrated database retrieval system