KEGG   Jatropha curcas: 105629914Help
Entry
105629914         CDS       T03922                                 

Definition
(RefSeq) thymidine kinase a isoform X3
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
jcu  Jatropha curcas
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    105629914
Enzymes [BR:jcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     105629914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 282 aa AA seqDB search
MLTAISRMKSLMAPPFSPICRPTSSALFFSLASKYKFLSSPSTLKNVNFLPIKPPPPVPI
FPIQNRCLQSKSSPSSSSGEIHVIVGPMFAGKTTTLLRRIESESRDGRNVAIIKSNKDTR
YGLDSIVTHDGLKLPCVALPNLSSFRQKFGADAYEQLDVIGIDEAQFFEDLYDFCREAAD
HDGKTVIVAGLDGDYLRKSFGSVLDIIPLADSVTKLTARCEICGSRAFFTLRKTEETRVE
LIGGADVYMPVCRQHYVSGQVVIEAAARIVVESQKVEFGSCV
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgttaactgctatttcaagaatgaagtcactaatggctccaccattttcacccatctgc
agacccacatcttctgccctcttcttctctttagcctctaaatacaaatttctctcatct
ccctcaactcttaaaaatgtcaactttctccccattaaacctcctcctcctgtgccaata
tttccaattcaaaatcgatgtctacagtctaaatcttctccttcttcttcatccggcgag
attcatgtcatagttggccctatgttcgccggaaaaaccaccacgcttctccgtcgcatc
gagtctgagagcagagatggcagaaatgtagcaatcataaaatcaaacaaggacacaaga
tatggtttggattcaatagtgacacatgatgggttgaagttaccatgtgtggcacttccc
aatttgtcgtcttttagacaaaaatttggtgctgatgcatatgaacagctggatgtaatc
ggtattgatgaagctcaattttttgaagacctgtatgatttctgccgtgaagctgctgat
cacgacggaaaaactgtaatagttgctggtctggatggtgactacttgaggaaaagtttt
ggttctgtgcttgatataattcctcttgctgattctgtgaccaagttaactgcacgatgt
gaaatttgtggaagtcgcgctttctttaccttgaggaagacggaggagacgcgggtagaa
ctcattggtggtgctgatgtgtatatgcctgtatgtcgacagcactatgtcagtggacaa
gtagtcattgaagctgctgcaagaatagttgtagaatctcagaaggtggagtttggatct
tgcgtgtag

DBGET integrated database retrieval system