KEGG   Jatropha curcas: 105631294Help
Entry
105631294         CDS       T03922                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
jcu  Jatropha curcas
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:jcu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105631294
Enzymes [BR:jcu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105631294
Chromosome [BR:jcu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105631294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 673 aa AA seqDB search
MEGGSGNNSVPPSPTFDKSRVLDVKPLRSLVPVFPSSPHTPPFVCAPPSGPFPSEFSPFY
PFSGPQPAPPDLNQQTHTPAPLRSFRPPQSNGQISRDVNTDDGPPKRSVGRPRASSSSSQ
KRAKKDLDFTLSVVDTNFVVGVTSAQKEDGDREVVNNVLMRFDALRRRLSQLEDSKESPS
GLIRRADLKAGNILMSKGVRTNMRKRVGVVPGVEVGDIFFFRMEMCLVGLHSQSMAGIDY
MVIRGDIEEDPLAVSIVSSGGYDDEAEDKDVLIYSGQGGNVNSNKKDKQAADQKLERGNL
ALERSLHRANEVRVIRGMRDVISPTAKVYVYDGLYRIQESWVDKGKSGCNIFKYKLVRVP
GQPGAFAVWKSIQQWREGFSTRVGLILPDLTSGSESIPVSLVNDVDEEKGPAYFTYFSTV
KYIKSFKLTEPSYGCNCRSACSPGDLNCSCIRKNGGDFPYTANGVLVNRRPLIHECGPTC
PCIPNCKNRVSQTGLKIRLEVFKTKDKGWGLRSWDPIRSGTFICEYAGEVIEKVKSRQDG
EGEDDDYVFDTTRVYEPFKWNCEPGLIEEDGNDTTEEYNIPSPLIISAKNVGNVARFMNH
SCSPNVFWQPVAYEHNSESYVHIAFFALRHIPPMTELTYDYGTSRSDEADGSGTPHGKKK
CLCGSPRCRGYFG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagggtctggcaataattctgtacctccttctcctacgtttgataaatccaga
gttttggatgttaaacctttgcgtagtttggtacctgtgtttccatcaagcccccatact
ccaccatttgtttgtgcacctccttctggtccgtttccatctgagttttccccattttac
ccttttagtggaccccaacctgcccctcctgacctcaatcaacagacccacactccagca
ccccttcgctcttttcggccgccacaatcaaatgggcagatatcgagagatgttaataca
gatgatgggccgccaaagcgttctgtggggcggccaagggcctcctcctcctcctctcaa
aagagggccaagaaagacctggactttacattgtctgttgttgatactaattttgttgtg
ggcgttacttccgctcaaaaagaggatggtgatagggaagtggttaataatgttctaatg
aggtttgatgcccttagaagaaggcttagccagttagaggattctaaggaatctccgtct
gggctaattaggcgtgcagacttgaaagcggggaatattttgatgagcaaaggggtcagg
acgaatatgaggaagagagttggagtggttcctggggtcgaggttggagatattttcttt
tttcgaatggagatgtgtttggtcgggttgcattcccagtccatggccggaattgattac
atggttataagaggtgatattgaagaagatccactggcagtaagtattgtttcatctggt
gggtatgatgatgaggcagaggataaggatgtgttaatttatagtgggcagggtggtaat
gtcaatagcaacaaaaaggataagcaagcagcggatcagaagcttgagaggggtaacctt
gcattggagaggagcttgcaccgtgccaatgaagtgagagtcattcggggaatgagggat
gtaattagtccaacagcaaaagtctatgtgtatgatgggctttataggatccaggagtcg
tgggttgacaaggggaagtctggttgcaatatattcaagtataagttggttagagtgcct
gggcagccaggtgcttttgctgtttggaaatcaattcagcagtggagagaagggttctct
acaagggttggactaattcttccggacctcacttcagggagtgaaagtatacctgtttcg
cttgtaaatgatgtggatgaagagaagggacctgcttacttcacctatttctctactgtc
aagtatattaaatcatttaaattgacagagccatcttatggatgcaactgccgtagtgca
tgctctccaggtgatctaaactgctcttgcattaggaaaaatggtggcgacttcccatat
actgccaatggggtcctagttaacaggaggccattgatccatgaatgtggtcccacatgt
ccatgcattcccaactgtaagaaccgagtgtcgcaaactggtttaaagattcgcttggaa
gtgtttaaaacaaaagacaaaggttggggcctgcggtcatgggatcctattcgttctggt
acttttatttgtgaatatgcaggtgaagttatagaaaaagttaagtcaaggcaggatgga
gaaggtgaagatgatgattacgtgtttgatacaacccgtgtttatgagccattcaaatgg
aattgtgaaccaggactcatagaggaggacggtaatgacactactgaggaatacaacatc
ccttctcctctaatcataagtgccaagaatgttggaaatgtagctcgatttatgaatcat
agttgtagtccaaatgttttctggcagccagtggcatatgaacacaacagtgagtcctat
gttcacattgccttttttgcattaagacacattccccctatgacagaattgacctatgac
tatgggacttcacgctcggatgaggctgatggtagtggtacaccgcatggaaaaaagaaa
tgcttatgtggatcaccaagatgccggggttattttggttga

DBGET integrated database retrieval system