KEGG   Jatropha curcas: 105635578Help
Entry
105635578         CDS       T03922                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
jcu  Jatropha curcas
Pathway
jcu00630  Glyoxylate and dicarboxylate metabolism
jcu00710  Carbon fixation in photosynthetic organisms
jcu01100  Metabolic pathways
jcu01200  Carbon metabolism
Module
jcu_M00165  Reductive pentose phosphate cycle (Calvin cycle)
jcu_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
jcu_M00532  Photorespiration
jcu_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:jcu00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    105635578
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    105635578
Enzymes [BR:jcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     105635578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small Swm2
Motif
Other DBs
NCBI-GeneID: 105635578
NCBI-ProteinID: XP_020535572
LinkDB All DBs
Position
Unknown
AA seq 171 aa AA seqDB search
MSASAGILTSAVAGSGYQGLKANSAKQLFPAKDSISWNSKTVSNGSRIHCMKTWNPINNK
KFETLSYLPPLSDDSIAKNIDYMIKMGWIPCLEFDEVGHVRRENSRMPGYYDGRYWTLWK
LPMFGCNDSAQVLNEMHECKKAYPNAYIRCLAFDNKKQCQCMSFIIQKPQL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccagtgccggaatccttacatctgcggttgctggatctggatatcaaggccta
aaagccaactcagcaaaacagctgttccctgctaaggattctatttcatggaacagcaaa
actgtctctaacggttccagaattcattgcatgaagacatggaatccaatcaataacaag
aagtttgagacactttcttaccttcctccactctccgatgactcgattgccaagaatatc
gattacatgataaaaatgggatggatcccttgccttgaatttgatgaggttgggcacgtg
cgtagagagaatagcagaatgccaggatactatgatgggagatattggacattgtggaag
ctcccaatgtttggttgcaatgactctgctcaggttctaaatgaaatgcatgaatgcaaa
aaagcatacccaaatgcttatatacgctgcttggcatttgacaacaagaagcagtgtcag
tgcatgtccttcatcattcaaaaacctcaactctaa

DBGET integrated database retrieval system