KEGG   Jatropha curcas: 105636156Help
Entry
105636156         CDS       T03922                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
jcu  Jatropha curcas
Pathway
jcu00250  Alanine, aspartate and glutamate metabolism
jcu00410  beta-Alanine metabolism
jcu00430  Taurine and hypotaurine metabolism
jcu00650  Butanoate metabolism
jcu01100  Metabolic pathways
jcu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jcu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    105636156
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105636156
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105636156
   00430 Taurine and hypotaurine metabolism
    105636156
Enzymes [BR:jcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105636156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 GST_C_6
Motif
Other DBs
NCBI-GeneID: 105636156
NCBI-ProteinID: XP_012074739
UniProt: A0A067KI31
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MVLSRAASDSDDSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAGINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPKKAVDLVDENTICVAAILGSTLNGEFEDVKLLNDLLTEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMENCRDNMVVLKEGLEK
IGRFEVVSKDMGVPLVAFSLKDNSNHNEFEISEMLRRFGWIVPAYTMPADAEHVTVLRVV
IREDFSRTLAERLVQDIERVLHELDTLPSRINAKNGDTVPAVPTKKSELETQREITTIWR
KFVMDRKKMSGVC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccagagcggcatcggattccgacgactccgtccactcaacgttcgcttcc
cgatatgtccgtacctcacttcctaggttcaagatgccggaaaactcgatcccgaaggaa
gcagcgtatcagatcatcaacgatgagctaatgttggatgggaatccaaggcttaacctg
gcctcctttgtaactacatggatggaacctgaatgtgataagcttattatggctggtatc
aacaagaactacgttgacatggatgagtacccggtcaccactgagttgcagaaccgatgt
gttaacatgatagcacatctgtttaacgccccacttggagattcagagactgcggttgga
gtgggaactgttgggtcttcagaggcaataatgttagctggattagcattcaagaggaaa
tggcagaacaagagaaaagctgaaggaaagcccttcgataagcctaacattgtcactggt
gctaatgttcaggtttgttgggagaaatttgctaggtattttgaagtagagttgaaggaa
gtgaagcttagagatgggtattatgtgatggatccaaagaaagcagtggatttagttgat
gagaacacaatttgtgttgctgctatccttggctccactcttaatggggaatttgaagat
gtaaagctcttgaatgatctcttgacagagaagaacaagcaaactggatgggatacccca
attcatgtggatgcagcaagtggtggatttattgcaccatttttgtatccagaacttgag
tgggattttagactaccattagttaagagtatcaatgttagtggtcacaagtatggactt
gtgtatgctggtgttggttgggtaatttggaggagcaaagaggacttgcctgaagaactt
atctttcatatcaattaccttggagctgatcaacctacctttaccctcaatttctccaaa
ggttctagtcaaattattgctcaatactatcaactcattcgcttgggttttgagggatac
aaaaacataatggaaaattgcagagacaacatggtggttctcaaggaaggactagagaag
attggtcgtttcgaggttgtttcaaaggacatgggagtgccactggtagcgttttcctta
aaagataatagcaaccataacgagtttgaaatttctgaaatgctaaggaggtttggttgg
attgtgcctgcatatacaatgccagctgatgctgaacatgtaactgtgttgcgtgttgtc
ataagagaggacttctcgcgaacactcgctgagcgtcttgtacaggacatagaaagagtt
ctgcatgaacttgataccttgccatccaggataaatgcaaagaacggtgacactgttcct
gcagtcccgacgaagaagagtgagttggagacacaaagggagattactacaatttggagg
aagttcgttatggacaggaaaaagatgagtggtgtttgttaa

DBGET integrated database retrieval system