KEGG   Jatropha curcas: 105636156Help
Entry
105636156         CDS       T03922                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
jcu  Jatropha curcas
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jcu00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    105636156
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    105636156
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105636156
   00430 Taurine and hypotaurine metabolism
    105636156
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    105636156
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    105636156
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    105636156
Enzymes [BR:jcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     105636156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MVLSRAASDSDDSVHSTFASRYVRTSLPRFKMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAGINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGDSETAVG
VGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELKE
VKLRDGYYVMDPKKAVDLVDENTICVAAILGSTLNGEFEDVKLLNDLLTEKNKQTGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNIMENCRDNMVVLKEGLEK
IGRFEVVSKDMGVPLVAFSLKDNSNHNEFEISEMLRRFGWIVPAYTMPADAEHVTVLRVV
IREDFSRTLAERLVQDIERVLHELDTLPSRINAKNGDTVPAVPTKKSELETQREITTIWR
KFVMDRKKMSGVC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggttctctccagagcggcatcggattccgacgactccgtccactcaacgttcgcttcc
cgatatgtccgtacctcacttcctaggttcaagatgccggaaaactcgatcccgaaggaa
gcagcgtatcagatcatcaacgatgagctaatgttggatgggaatccaaggcttaacctg
gcctcctttgtaactacatggatggaacctgaatgtgataagcttattatggctggtatc
aacaagaactacgttgacatggatgagtacccggtcaccactgagttgcagaaccgatgt
gttaacatgatagcacatctgtttaacgccccacttggagattcagagactgcggttgga
gtgggaactgttgggtcttcagaggcaataatgttagctggattagcattcaagaggaaa
tggcagaacaagagaaaagctgaaggaaagcccttcgataagcctaacattgtcactggt
gctaatgttcaggtttgttgggagaaatttgctaggtattttgaagtagagttgaaggaa
gtgaagcttagagatgggtattatgtgatggatccaaagaaagcagtggatttagttgat
gagaacacaatttgtgttgctgctatccttggctccactcttaatggggaatttgaagat
gtaaagctcttgaatgatctcttgacagagaagaacaagcaaactggatgggatacccca
attcatgtggatgcagcaagtggtggatttattgcaccatttttgtatccagaacttgag
tgggattttagactaccattagttaagagtatcaatgttagtggtcacaagtatggactt
gtgtatgctggtgttggttgggtaatttggaggagcaaagaggacttgcctgaagaactt
atctttcatatcaattaccttggagctgatcaacctacctttaccctcaatttctccaaa
ggttctagtcaaattattgctcaatactatcaactcattcgcttgggttttgagggatac
aaaaacataatggaaaattgcagagacaacatggtggttctcaaggaaggactagagaag
attggtcgtttcgaggttgtttcaaaggacatgggagtgccactggtagcgttttcctta
aaagataatagcaaccataacgagtttgaaatttctgaaatgctaaggaggtttggttgg
attgtgcctgcatatacaatgccagctgatgctgaacatgtaactgtgttgcgtgttgtc
ataagagaggacttctcgcgaacactcgctgagcgtcttgtacaggacatagaaagagtt
ctgcatgaacttgataccttgccatccaggataaatgcaaagaacggtgacactgttcct
gcagtcccgacgaagaagagtgagttggagacacaaagggagattactacaatttggagg
aagttcgttatggacaggaaaaagatgagtggtgtttgttaa

DBGET integrated database retrieval system