KEGG   Jatropha curcas: 105639000Help
Entry
105639000         CDS       T03922                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH2
Organism
jcu  Jatropha curcas
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 105639000
NCBI-ProteinID: XP_012078323
UniProt: A0A067KCX7
LinkDB All DBs
Position
Unknown
AA seq 2200 aa AA seqDB search
MGSCENSLEVHEPLQQAYIEQHLCSIKNSDSEKLPCSEAGVDVIDNDVGPTGALDGFLEL
SQNDSAGCVSSSELRGAESVDWVIGSATEVECGNERQSGIDDCSVETDGFCVEKEASNNE
NNGSENSLEDCERSLELVHASSSVRNCDQQDEEKDDWNVRREMEEKTDGLAGTKIETCDQ
MMPSFNCEMPAELIAVDALAINGVEPDKDIRAILERAVVVMENKTAGLVEIDTDNHSQTG
PASNYVQLDDQKDQQLNNSPSAKVVTEVIKTNSNVSPMIETIAHNQLFSCQGFDEALELM
PKTDSSEESIKQEEQNDDGSITLPSEQGVMEKKSNLSTGVKCNLNNQTFSSMDDEMHVEL
DPFPLLPKHSCQQNDLEAKTVNSVGSMGVVNGKSDASATTDSDICIQKTLHHIAMPKESS
ITGSLESTCERKNDQKNGFSVNCFTAETVSTDILKKSGVDKCIQAYPSQACQRTLENLAI
ADSLGNPVYEPFIEGMPGIVEEESDVTTEIKFEIHGQKFCVEGDAYDLKEGSPEKTPSSA
QSCQPFGKDVSHDIYSSHSVDCSEQIDKEGKVLAGSCPSKTTCLDIGSSSSRRSKRIRKS
GQKTQTKRAAKKRKNKAKLQDLQIFKADRRKRSCFSKPARSSNWGLLGNITQFFEQSNGL
GLNEIQYCGPRKIKVEQGNGKRGNSQPSGSSQKSSGKKNSSTGGIRLKVIVRKEVGQNSL
NLVVPEVIDTSTSGVLVSEFEAKTYTGTSSKIPNVVSGAEDKMGEREREEQLQCFGNKLE
EAKVYPNASVSDFHVADKDFEGHLICQNSAVDAAADYLGVPSHLEVDISGEATEKRYTDP
GTSPDSEVINLVPEGQVNATCQEDLHDVVLTSPKAFVAAGAVARGKKGKKKDRRIRVSDN
FAEDISPGMSSMKSVKTTKKHGGRQGKDDGFLSSQILISPTKANVSSNFSSHKEFSEEQL
HLSRKTEFRVSEEALQAESGLDFGPRLSESQNSNNLLHSVKSKSKGGQLPKKSDGASKRR
SKTSDKARSKKENGCGQRGSERKTVNKNKAKEKSECDHVYKSADNPETGNCIAKDTGKTN
PVDSVASIDVANLDMASTDAVEQQPPADNAWVRCDDCHKWRRIPVTLVDLIGQSNCQWIC
EDNMDKAFADCSIPQEKSNAEINAELGLSDADEDAYDAPLKNKGLEWKRTAVSKEHEFTR
ISTNQFLHRCRKTQTIDEIMVCHCKLPLHGGLGCGDECLNRMLNIECVQGTCPCGDLCSN
QQFQKRHYAKMQWARCGKKGFGLRLEEDISKGQFLIEYVGEVLDMHTYEVRMREYASMSH
KHFYFMTLNGSEVIDACAKGNLGRFINHSCDPNCRTEKWVVNGEICIGLFALRDIKKGEE
VTFDYNYVRVVGAAAKQCYCGSPQCRGYIGGDPTSTEVIDQVDSDEEFPEPVMLEDGEAG
ERFKNRLSRISSFDGVELQVAESISKDRNKMDISTTATEKMEVGLEIEDGMNQSVSAISQ
LSSPMEMNDSRGDIPSSSQPVEMSAQADDVISKSASPVKQEISKEDIQSGETCPTAMLSK
LSSDGMVANRKSKSATAEEKRVFVKSRFLIKTSHHSGSGKKGKFTSNPTNANKVQMVASK
SQLLSIKPKRSIDGTSNGRFEAVEEKLNELLDADGGISKRKDAPKVYLKLLLLTAASGAS
GNGEAIQSNRDLSMILDALLKTKSRVVLIDIINKNGLRMLHNMIKQYRWDFKKIPILRKL
LKVLEYLAVREILTPEHINGGPPCPGMESFRESMLLLTEHNDKQVHQIARNFRNRWIPQH
GRKYRHEDRDDGRMEFHRGSVNNRVSVPLNHSRDLGVRPTEAIECASQSKLATASSVDSA
VHEGCSAPSVGGVVKTRKRKSRWDQPAEEKPSSRSLQSDGQKIQSGLLQQSEYHSQPEMG
KEILDNVEKGSKENSYCPHCALNYYLQDEVSCADDGRQNMQSDVPPGFSSPLNQNLVSSS
SSSTITEIQQQNGCMASPIGTVVGHPQEKFISRMYVSYGIPLPIVQQFGSPRDGKVESWT
VAPGMPFHPFPPLPPFPQHKKETPSPAVNSMVINGSTEERQRDRHDLATCYPNENNPSTA
GGNQPDMDIPSENGQQAFKRARGSSHDLGKRYFRQQKWNKVLPPWIRNRDGFGCLGNNSR
GGICTDVGSLTNDHRNSYCSQDVSCRVEKAGNCINQQKST
NT seq 6603 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgtgtgagaactcacttgaggtccacgaacctttgcaacaagcttatattgag
cagcatttgtgctcaattaaaaattctgattctgagaaactgccttgctcagaggctggt
gttgatgtgattgataatgatgtgggtcccactggtgctctagatgggttcctagagtta
tctcaaaatgatagtgctggttgtgtgagctctagtgaattaaggggcgccgagtctgtt
gattgggtaattgggtcagccacagaggttgaatgtgggaatgagaggcaaagtggaatt
gatgattgcagtgtggaaactgatggattttgtgtggaaaaagaagcttctaataatgaa
aacaatggatcagagaattcattggaggattgtgaaaggtctctggaattggtgcacgct
tccagttcagtcagaaattgtgatcaacaggatgaagagaaggatgactggaatgtccga
agggaaatggaagagaaaactgatggtttagctggaacaaaaattgaaacttgtgaccaa
atgatgccttcatttaactgtgagatgccagcagaattaatagcggtggatgctttggct
ataaatggagttgaaccagacaaggacatccgtgctattttggagagggctgtggtggtc
atggaaaataaaactgctggtttggttgagatagatactgataatcacagccaaacagga
ccagcgagtaattatgttcagctggatgaccagaaagatcaacagttgaacaatagtccc
tctgcaaaagtggttacagaggttataaaaacaaatagcaatgtttcacctatgatagag
actattgctcataatcagttgttctcttgtcaaggctttgatgaggccttggaattaatg
cctaagactgattcctcagaagaaagtattaaacaggaagagcagaatgatgatggttct
attactctgccttctgagcaaggagttatggaaaagaaaagtaatctttctactggggta
aaatgtaacctaaataaccaaacattctcctcaatggatgatgaaatgcatgtggaatta
gatccttttcctctcttaccaaaacatagttgccaacaaaatgacctggaggccaagact
gttaacagtgtaggttcgatgggggttgtgaatgggaaaagtgatgcttcagccactacg
gattctgatatatgcatacagaaaacactccatcacattgcaatgccaaaggaatcatca
attactggttctctggagagtacttgtgaaaggaagaatgatcagaaaaatggctttagt
gttaattgttttactgcagaaacggtttctacagatattttgaagaaaagtggtgtggat
aaatgcatccaggcatacccttcacaggcttgccagaggaccttggagaatttagctatc
gctgactcactgggtaaccccgtctatgaaccctttatagaaggcatgccaggcattgta
gaagaggaaagtgatgtgacaactgaaataaagtttgagattcatggccagaaattttgt
gtggaaggagatgcctatgatctgaaggaagggtcacctgaaaaaactcccagcagtgca
cagtcatgccagccctttgggaaggatgtttctcatgatatttattctagccatagtgtt
gactgttctgaacagattgataaggaagggaaggttcttgctggaagttgtccttccaaa
accacatgtctagacattggctcatcctcttcacgaaggagcaaaagaattcgtaaatcc
ggtcagaaaactcagacaaaaagagctgcaaagaaacgcaagaacaaagctaaactgcaa
gacctgcagatcttcaaggctgatagaaggaagagaagctgtttctccaaaccagctcgc
tcttctaactggggattattagggaatatcacccaattttttgagcagagtaatgggctg
gggctcaatgaaattcagtactgtggaccaagaaaaataaaggttgaacaagggaatgga
aagaggggtaatagtcagcctagtggaagctcccagaagtctagtggaaaaaaaaattct
tcaactggtggtattcgcttgaaagttatagtcagaaaagaagttggtcaaaatagtctg
aacctggtggtcccagaagtaattgatacctcaacatctggtgttcttgtcagtgaattt
gaggctaaaacatacacaggaacaagttccaaaatcccaaatgttgttagtggtgctgaa
gataaaatgggggaaagggagcgtgaagagcagcttcaatgttttggcaataagctggag
gaggcaaaagtataccccaatgcttctgtttcagattttcatgtagcagataaggacttc
gagggccatttgatttgccagaactcagctgttgatgctgcagcggactatcttggagtt
ccctcacatttagaggttgatatatccggggaggcaactgagaagaggtatactgatcct
ggaacttcaccagactcagaagttatcaatttagttcctgaaggccaagtcaatgcaaca
tgtcaagaagatctccacgatgttgttttgacttctcctaaagcttttgttgccgctgga
gctgttgctaggggtaagaaaggaaagaagaaagatagacgcatccgtgtcagtgacaat
tttgcagaagatatatctcctggtatgtcgagcatgaaaagtgttaaaacaacaaagaag
cacgggggtaggcagggaaaggatgatggatttctctctagtcagattcttatttcacct
actaaagcaaatgtttctagcaacttttcaagccataaagaattttctgaggaacagtta
catttgtctagaaagaccgaatttagagtctctgaagaggctttgcaagcagaatctggc
cttgattttgggcctagattgtcagaatcacagaattcaaataatctgcttcattcagtt
aaatctaaatccaaagggggtcaacttccaaagaaatctgatggagcaagcaagagaagg
tccaagacctctgacaaagcaaggagcaagaaagaaaatggttgtggacagagagggagt
gaacggaagacagttaataaaaacaaagccaaggagaagagtgaatgtgatcacgtttat
aaatcagcagataatccagaaacaggaaattgtattgctaaggacactgggaaaaccaat
cctgttgacagtgttgcctccatagatgttgctaatttggacatggcatcaactgatgca
gtggagcagcagccacctgctgataatgcttgggtgcgctgtgatgattgtcataaatgg
cggcgtattcctgttacacttgtagatttgattggtcaatcaaattgccaatggatctgc
gaggacaacatggataaagcctttgctgattgctccatcccccaggagaagtcaaatgca
gaaattaatgcagagttaggcttatcagatgctgatgaagatgcctatgacgccccttta
aagaataagggattagaatggaagcgtactgcagtttccaaggagcatgagtttacgcgt
atctctactaaccagtttctgcatcgttgccggaagacgcagactattgatgagataatg
gtttgccattgcaaattacctctacatggtgggttaggttgtggagatgaatgcttgaat
cgcatgcttaatattgagtgtgttcaaggcacctgtccatgtggggacctgtgttcaaat
caacagttccaaaagcgccattatgcaaaaatgcagtgggctcgatgtgggaagaaaggt
tttggtctgcgattggaggaggatatttctaaagggcaatttcttattgaatatgttgga
gaggtgcttgatatgcatacttatgaggtgcgaatgagagagtatgcttctatgagtcat
aagcatttctacttcatgacactgaatggcagtgaggtaatagatgcttgtgcaaaagga
aacttggggcgtttcattaaccatagttgtgatcctaattgtcgtactgaaaagtgggta
gtcaatggagagatttgtattggactctttgcactgagggatattaagaagggtgaagag
gtgacatttgactacaactatgtaagagttgttggagctgctgcaaaacaatgttactgt
gggtcacctcaatgtcgaggctatattggtggcgatccaacaagcactgaggtaattgat
caagttgattcagatgaagaatttcctgaaccagtgatgcttgaagatggggaagctgga
gagagattcaagaatagattatccaggatcagttcctttgatggtgtagaactgcaagtt
gcagagagtatatctaaagatagaaataaaatggatatttctacaacagctactgagaaa
atggaggttggccttgaaattgaggacggcatgaaccaatctgtctctgccatttcccaa
ttaagcagcccaatggaaatgaatgattcaaggggagatattccatcttctagtcagcca
gtagaaatgtctgctcaagcagatgatgtaatcagcaaatctgcatctcctgtcaagcaa
gaaatttcaaaggaagatattcaaagtggggagacctgtccaactgcaatgctgagcaaa
ttatcatctgacggtatggttgctaacagaaagtccaagtctgctacagcagaagaaaaa
cgggtttttgttaaatcacgttttctgattaaaacttcgcatcattctggttccggtaag
aaaggaaagtttactagtaatcctacgaatgctaataaagttcagatggtggctagcaaa
tctcagttgttgtctatcaaacccaaaagatctatagatggtacttctaatggtcggttt
gaggcggtcgaggagaaacttaatgagttattggatgctgatggtgggataagcaaaaga
aaagacgcccctaaagtctacttgaagcttctgcttcttactgcagcatctggtgccagt
ggaaatggtgaagcaattcagagcaatcgagatctatcaatgattcttgatgcacttcta
aaaactaaatcacgagttgtgttgattgatataattaacaaaaatggtttgcgaatgctc
cacaacatgatcaagcaataccgatgggactttaaaaagattccaattctccgaaagctt
ctgaaggtgttggagtatttggctgtcagggagatacttacaccagaacatattaatgga
ggtcctccttgccctggaatggagagctttagggagtcaatgttgttattgacagagcac
aatgacaaacaggttcatcaaattgcacggaatttccggaacagatggattcctcaacat
ggcagaaaatatagacatgaggatagggatgatgggaggatggagtttcacagaggttca
gttaataatagggtttcagttccactgaatcattcacgtgatctaggtgtaaggcctacg
gaagcaatagagtgtgccagccagtcaaagctagcaactgcctcttctgtggactctgct
gtccacgagggctgttctgcaccttctgttggcggtgtggtaaaaactcgcaagcgtaaa
agccgatgggatcaaccggctgaggaaaaaccatcttcaagatctcttcagagtgatgga
cagaagattcaatccgggttgctacaacagtctgaataccactcacaacctgaaatgggt
aaagaaatattggataacgtagaaaaaggaagcaaagagaatagttattgcccccattgt
gctctcaattactatctacaagatgaagtcagttgtgctgatgacggaaggcagaatatg
caaagtgacgttccacctggattctcatctccccttaaccagaatctggtttcatcaagt
tcttcatcaacaattactgaaatccaacaacaaaatggttgcatggcatctccaattggt
acagttgttgggcatccacaggagaaattcatttcacgtatgtatgtctcttatggaatt
ccgttgcctattgttcagcaatttgggtcacctcgggatggaaaagtggagagttggaca
gttgctccaggcatgcctttccatcctttcccgccacttcctccatttccccaacataag
aaagaaactccatctcctgctgttaattccatggtgataaatgggtctacagaagaaagg
caacgagacagacatgatcttgccacttgttatccaaatgaaaacaatccaagcacagct
ggtggtaaccagccagatatggatatacctagtgaaaatggccaacaagcatttaaacga
gctaggggatcctcgcatgatttgggaaagagatactttaggcagcagaagtggaataaa
gtgctgcccccttggatacggaatagggatgggtttggatgcttgggaaacaactcaaga
ggtggaatatgtaccgatgtaggaagtctaacaaatgatcacagaaattcatactgttca
caggatgtaagctgtagagtggagaaagctggaaattgcattaatcagcaaaaaagtacc
taa

DBGET integrated database retrieval system