KEGG   Jatropha curcas: 105648314Help
Entry
105648314         CDS       T03922                                 

Definition
(RefSeq) hexokinase-3 isoform X1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
jcu  Jatropha curcas
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:jcu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105648314
   00051 Fructose and mannose metabolism
    105648314
   00052 Galactose metabolism
    105648314
   00500 Starch and sucrose metabolism
    105648314
   00520 Amino sugar and nucleotide sugar metabolism
    105648314
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105648314
Enzymes [BR:jcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105648314
Membrane trafficking [BR:jcu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105648314
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MGRVALGVAVGVAVVACAVAGVVVGRRVRSRKKWRRVLGVLKELEESCETTIGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTYVDHLPTGSEIGTYYALDLGDTNFRVLRVQLGGRESL
MLSKDVEQQPIPQHLMTSSSEDLFDFIASTLKQFVEKEESGSEFASVRTRELGFTFSFPV
KQTSIRTGNLIKWTKGFAIEDMVGRDVLECLQAGLTRNGLDMQVVLLVNDTVGSLALGHY
CDADTVAAVIIGTGTNACYLERADAIIKCQGLLTTSGGMVVNMEWGNFWSSHLPRTSYDI
DLDVESLNPNDQGFEKMISGMYLGDIVRRVILRMSQETDIFGPVSSRLTTPFILETYLVV
DMHEDDSPDLQEVARILKEILEITEIPLKARKLVVRICDVVTRRAARLAAAGIVGILKKI
GRDGTGGITSGRGRSDIKMKRTVVAIEGDLYTTYTMFREYLHEALNEILGEDVAPHVILK
ATEDGSGIGAALLAASYSS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggaagagtggctttgggagtggcggtgggtgtggcggtggtggcatgtgcggtggcc
ggggtggtggtaggcaggagggtaaggagtcggaagaagtggaggagagtgctgggagta
ttgaaggagttggaggagtcttgtgaaaccacaattggaaggttgaggcaagtagttgat
gctatggctgtggagatgcatgctgggttggcttctgaaggaggctctaagctcaaaatg
ttgctcacttatgtggaccatttacctacggggagtgagataggaacttattatgctcta
gatcttggggatactaattttagggtcttgcgggttcagctaggaggcagagagtcctta
atgttgtcaaaagatgtggagcaacaacctattcctcagcacttgatgacaagcagtagc
gaggatctctttgacttcattgcttcaacattaaagcagttcgttgaaaaagaagaaagt
ggttccgagtttgcttcagttagaacaagggaacttggatttacattctcctttcctgta
aaacaaacgtctattcgtacagggaacctcatcaaatggacaaaaggatttgctatcgag
gacatggttggaagagatgttcttgaatgtttacaagcgggattgaccaggaatggtcta
gatatgcaggtcgtcttgttggtaaatgatactgttggatcactagctcttggacattat
tgtgatgctgacactgttgctgcagtaataattggaacgggtactaatgcttgctatcta
gagcgggctgatgctattataaagtgtcaaggccttcttacaacttctggaggcatggtt
gtcaacatggaatggggaaatttctggtcatctcatttgccaaggacttcctatgatatt
gatttagatgttgaaagccttaacccaaatgatcagggttttgagaaaatgatatccgga
atgtatctaggtgacattgttaggagagtgattctcagaatgtcacaggagacggacatc
tttggacctgtttcctccagattgacaacaccgtttattttggaaacatatcttgttgtt
gacatgcacgaggatgactctcctgatctgcaggaagtggctagaatcttgaaagaaatt
ctggagatcacagaaattcctttgaaggctagaaagcttgttgttagaatatgtgatgta
gtgacccggagggctgcaaggttggcagcagctggcattgtgggaatattaaagaagatt
ggccgggatgggactggggggatcaccagtggaagaggtagaagtgacataaaaatgaaa
agaacagttgtggcaattgaaggggatttatatacaacctatacaatgttcagggaatac
ttgcacgaagccttgaatgaaatattgggggaggacgttgccccacacgtaattcttaaa
gccacagaagatggatcaggcataggagcagctctccttgctgcctcgtattcatcctga

DBGET integrated database retrieval system