KEGG   Jeotgalibaca dankookensis: BW727_101789Help
Entry
BW727_101789      CDS       T04733                                 

Gene name
amyS
Definition
(GenBank) Alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
jda  Jeotgalibaca dankookensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jda00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BW727_101789 (amyS)
Enzymes [BR:jda01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BW727_101789 (amyS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1812989..1814479)
Genome map
AA seq 496 aa AA seqDB search
MTRNGLMMQYFEWHLPNDGQLWNNIKDDAEHLKEMGVTSVLLPPAYKGTQQSDVGYGVYD
LYDLGEFDQKGTVRTKYGTKEEYIAAIKALHDHDIFVYADVVLNHKAGADETERFMAYEV
NPENRQEKISEPYEIEGWTKFNFEGRNDTYSDFKWNWRHFSGTDYNDADGKKAIFMIKGL
EKGWNDNETVDNEFGNYDYLMFADIDYENEEVIEETKKWAEWYINETGVDGFRLDAVKHI
SSPFIDDLLKEIRANNRPDFFVVGEYWKYDLPAIHEFLEDTDYGLDLFDVPLHFNFKEAG
EAGSSYDLSQLYDGTLASENPTHAVTFIDNHDSQPGQALESFVASWFKPLAYASILLREE
GFPCLFYGDYYGIGGEDSVEAQSEWLDNLLYLRRSHAYGEQHDYFDHPNCVGWTREGDEN
HPYGLAAIISNSEAGEKEMYVGKQYAGKTFTDYTGHLDDKIVIDEEGKAVFLVNGGSVSV
WVQEGITPEEAYQENN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgactagaaatggattgatgatgcaatatttcgaatggcatttacctaacgacggacag
ttatggaataatatcaaggatgatgccgaacatttgaaagaaatgggtgtgacatctgtt
ttacttccacctgcttataaaggtacgcaacaatcggatgtgggatatggtgtttatgat
ttatatgatttaggagagtttgatcaaaaaggaacagttcgcacgaaatatggaacaaaa
gaagagtatatcgccgctattaaggcgctccatgaccatgatatcttcgtttacgctgac
gttgtattaaatcataaggctggagcagatgaaacggaacgttttatggcctacgaagta
aatccagaaaatcgtcaagaaaaaataagcgaaccctatgaaattgaagggtggacaaaa
tttaattttgaaggtagaaatgatacttattctgatttcaaatggaattggcgtcatttt
agtgggacagattacaatgatgcggatggaaaaaaagctatttttatgattaaaggttta
gaaaaaggatggaacgataacgaaaccgttgataacgagtttggtaattatgattattta
atgtttgcagatattgattatgaaaacgaggaagttattgaagaaacaaaaaaatgggcg
gagtggtatattaacgaaaccggtgttgatggtttccgtttggatgcagtgaaacatatt
agttcaccttttatcgacgatcttctaaaagaaatccgtgccaataatcgtccagatttt
tttgtggtaggtgaatattggaagtacgatttaccagctatccatgagttcctagaagat
accgattatggcttagacttgtttgacgtgcctttgcactttaactttaaggaggcagga
gaagcaggaagtagctatgacttaagtcagttatatgatggaacgctcgcttcagagaac
cccacccatgcagtgacttttattgataaccatgattcacaacctggtcaagctttggaa
tcgtttgtagcaagttggttcaagccattggcatatgcatccattcttttacgtgaagaa
ggctttccatgtttattttatggcgattactatggtatcggcggcgaggatagtgttgaa
gcccaatctgaatggttagataatttactctacttgagacgcagtcatgcttatggagag
caacatgattattttgaccatcctaactgtgttggctggacaagagagggagacgaaaac
cacccttacggtttggctgctattatttccaacagtgaagctggggaaaaagaaatgtat
gttggcaaacagtatgcaggaaaaacctttactgattatactggtcatttagatgataaa
attgtaattgatgaagaaggaaaagctgttttcttagtaaatggtggttctgtttctgtt
tgggtgcaagaaggaattactcccgaagaggcataccaagaaaataactaa

DBGET integrated database retrieval system