KEGG   Jeotgalibaca sp. PTS2502: BW721_08890Help
Entry
BW721_08890       CDS       T04689                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
jep  Jeotgalibaca sp. PTS2502
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jep00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BW721_08890
Enzymes [BR:jep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BW721_08890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1774854..1776350
Genome map
AA seq 498 aa AA seqDB search
MLENGIMIQYFEWELPNDGQLWKKLKEDTPHLKEIGVSAVWLPPAYKGTDQKDVGYGVYD
LYDLGEFDQKGTVRTKYGTKEEYLAAIETLHEHNISVYADVVLNHKAAADEAERFYAAEV
NPDNRQEKLTDFYEIEGWTKFTFPGRGKTYSDFQWHWEHFTGTDFNKENEKEAIYLIKGL
NKGWSDNGLVDDEFGNYDYLMYADIDFQNPAVVEEIKRWAHWYIEETGVDGFRLDAIKHI
NRNFIKELVADIRGNGRPDFFVVGEYWKNDYGTIQDYLEATEFSIDLFDVTLHYNLHQAS
KAGADYDLRQIFKDALINKDPVNAVTFVDNHDSQPGQSLESYVEPWFKLLAYAIILLRRE
GFPCLFYGDYYGIGGENPIEPFTDSLNKLLYLRSNHAYGEQQDYFDDANYVGWTRMGDVE
HPYGMAVVIANKDQDGVKEMHVGEQYAGETFADYLGHLEDKIVIDENGCGQFPVAGNSVS
VWVKDAVTPEEAYNEEII
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaatggaatcatgatacagtattttgaatgggaattaccgaatgatggacaa
ttatggaaaaaactaaaagaagatactccgcacttaaaagaaattggggtgagtgcagtt
tggctaccacctgcctataaaggaacagatcaaaaggatgtcggttatggtgtgtatgat
ttatatgacctaggtgaatttgaccaaaaagggactgttcgcacaaaatacggtacgaaa
gaggagtacttggcagctattgaaacgcttcatgaacataatatctctgtctatgcagac
gttgttttaaaccacaaagctgctgctgatgaggcagagcgcttctatgcagctgaggtc
aatccagataaccgtcaagaaaaactaacagatttttatgaaatcgaaggctggactaaa
tttaccttccctggacgaggaaagacttattctgatttccaatggcattgggaacatttt
acagggacagactttaataaagaaaatgagaaggaagccatctatcttattaaaggcttg
aacaaaggttggagcgataacggcttagttgatgatgaatttggtaactatgactatttg
atgtacgctgatattgattttcaaaatccagcagttgttgaagagattaaacgttgggcg
cactggtatattgaggaaacaggcgtagatggtttccgtttagatgctattaaacacatt
aatcgtaacttcattaaagaattagtggcagacattcgagggaacggccgtcctgatttc
tttgtcgttggtgagtattggaaaaatgactacgggacgattcaagattatttagaagca
acggaattttcaattgacttgtttgatgtgaccttgcattacaatcttcaccaagcgtca
aaggcgggtgctgattatgacttgcggcagatttttaaggatgccttaattaacaaggat
ccggtcaatgctgttacattcgtcgataatcatgattcacagccgggtcaatccttagaa
tcctacgtagagccatggtttaaactattagcctatgccattattttactgagacgtgag
ggcttcccatgcttattctatggggattattatggcatcggtggtgaaaatccgattgaa
ccttttacagatagcttgaataaattactttatttaagaagtaatcatgcttacggtgaa
caacaggattattttgacgatgctaactatgtcggttggacacgtatgggagatgtggag
cacccttatggtatggccgtcgtcattgcaaataaagaccaagacggagttaaggagatg
catgttggcgaacaatatgccggcgaaacattcgctgattatcttggacatctggaggat
aagattgtgattgatgaaaatgggtgtggtcaattccccgtagcaggtaattctgtttca
gtttgggtaaaggatgccgtcacaccagaagaagcttataacgaagagattatttaa

DBGET integrated database retrieval system