KEGG   Jeongeupia sp. USM3: BJP62_00905Help
Entry
BJP62_00905       CDS       T04552                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
jeu  Jeongeupia sp. USM3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:jeu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJP62_00905
  Amino acid metabolism
   00310 Lysine degradation
    BJP62_00905
   00380 Tryptophan metabolism
    BJP62_00905
Enzymes [BR:jeu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BJP62_00905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
188065..190878
Genome map
AA seq 937 aa AA seqDB search
MMTEYQVSSHLFGGNAPFIEELYEQYLADPTSVDGKWREYFDRLQQTAGAIERDVPRAPI
EESFRQMARKPRIVAAAGAADEKAVRQQINLLRLISAYRVLGSRNAALDPLRRMDQAYVP
ELDPKHHGFSDADQAKVFGTNIAGMEKASLAEVLSFLKQTYCGSIGLEYMHITRSDEKHW
VQQWFESRRSTSQYNASQKKRILKQVTAAETLEQYLHKKYVGQKRFSLEGGDSLIPAMDY
LTQLSGATGVQEIVIGMAHRGRLNMLVNILGKQPRDLFSEFEGRYTTQLASGDVKYHMGF
SSDIPTAHGPVHLSLAFNPSHLEIVNPVVVGSVRARQQRRNDKTGDQVLPVLIHGDSAFI
GLGTNQGTFNLSQTRGYGTGGTVHIVVNNQVGFTTSDVRDNRSTLYCTDIAKMVEAPVFH
VNGDDPEAVCLVVEAAMAFRKTFRKDVVIDIVCFRRWGHNEADDPFVTQPMMYKKIGQHP
GVRKKYADRLVAEGVVSEAEASEMIDAYRAALDRGEHVEQTTLTDYKRNFAIDFGKYMGN
HWRHPVDTAVRLGGLQRLAEKFNAVPENFKLRANVEKILKERGEMVAGNAPVDFGMAESL
AYATLVTEGYAVRISGEDSGRGTFNHRHAVVHDQNREKWDQGAYIPLQHLSDSQAHFTVI
DSILNEEAVLAFEYGYASSAPEELVIWEAQFGDFANGAQVVIDQFITSGETKWGRLCGLT
MMLPHGYDGQGPEHSSARVERYLQMCAEHNVQVVQPSEASQIFHVLRRQMLRPVRKPLII
IMSKRLLKAKFAASPIEQFSSGAFRNVIGDTAELDAKKVKRVLVCAGQVYYDLATARAER
EIKDIAIVRVEQLYPFPTEELQAEFEKYPNAREVVWVQEEPRNQGAWHQIRHRLEGCTSP
KQELKFAGRPSSASPAVGYMSKHTAQLKAFVDEALTL
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgagtatcaggttagttctcacctcttcggcgggaatgcaccgtttatcgag
gaactgtacgaacagtacctcgccgatccgacgtcggtggacggcaaatggcgcgagtat
ttcgaccggctgcagcagacggccggtgcgatcgagcgcgatgtgccgcgtgcgccgatc
gaggaatcgttccgccagatggcccgcaagccgcgtatcgtcgccgctgcgggtgccgcc
gacgagaaggcggtgcgccagcagatcaacctgctgcggctgatctccgcctaccgcgta
ctcggcagccgcaacgcagcgctcgatccgctgcgccggatggaccaggcctacgtgccc
gagctcgatccgaagcatcacggcttctcggatgccgaccaggccaaggtcttcggcacc
aacatcgccggcatggaaaaggcttcgctcgccgaggtgctgtccttcctgaagcagacg
tactgcggcagcatcggcctcgagtacatgcacatcacccgctcggacgagaagcactgg
gttcagcaatggttcgagtcgcgccgttcgacctcgcagtacaacgccagccagaagaaa
cgcatcctcaagcaggtcaccgcggcggaaacgctcgagcagtacctgcacaagaagtac
gtcggccagaagcgcttctcgctcgaaggcggcgattcgctgattccggcgatggactac
ctgacccagctgtccggtgcgaccggcgtgcaggaaatcgtcatcggcatggcccaccgc
ggccgcctgaacatgctggtgaacatccttggcaagcagccgcgcgacctgttcagcgag
ttcgaaggccgttacaccacgcagctcgcctcgggcgacgtgaagtaccacatgggcttc
tcgagcgacattccgaccgcccacggcccggtgcacctgagcctcgcgttcaacccgtcg
caccttgaaatcgtcaacccggtggtggtcggttcggtccgcgcgcgccagcagcgccgc
aacgacaagaccggcgaccaggtgctgccggtgctgatccacggcgactcggccttcatc
ggcctgggcaccaaccagggcacgttcaacctgtcgcagacgcgcggttacggtaccggc
ggtaccgtgcacatcgtcgtcaacaaccaggtcggcttcacgacctcggacgtgcgcgac
aaccgttcgaccctgtactgtaccgacatcgccaagatggtcgaagcgccggtcttccac
gtcaacggcgacgatccggaggccgtgtgcctcgtggtcgaagcggcgatggcgttccgc
aagaccttccgcaaggacgtggtcatcgacatcgtctgcttccgtcgctggggccacaac
gaggccgacgatcccttcgtcacccagccgatgatgtacaagaagatcggccagcacccg
ggcgtacgcaagaagtacgccgaccgtctcgtggccgaaggcgtcgtttccgaagccgaa
gccagcgaaatgatcgacgcctaccgcgcggcactggatcgcggcgagcacgtcgaacag
accacgctgaccgactacaagcgcaacttcgcgatcgacttcggcaagtacatgggcaac
cactggcgccacccggtcgataccgcggtgcgtctgggcggcctgcagcgtctggccgag
aagttcaacgcggtgccggaaaacttcaagctgcgcgccaacgtggagaagatcctcaag
gaacgcggtgaaatggtcgccggcaacgcgccggtcgacttcggcatggccgagtcgctc
gcctatgccacgctggtgaccgaaggctacgcggtgcggatttcgggtgaagactcgggc
cgcggcaccttcaaccaccgccacgccgtcgtgcacgaccagaaccgcgagaaatgggac
cagggcgcctacattccgctgcagcacctgtcggacagccaggcgcacttcaccgtcatc
gactcgatcctgaacgaggaggcggtgctggcgttcgaatacggctacgcctcgtcggcg
ccggaagagctggtgatctgggaagcgcagttcggtgacttcgccaacggcgcgcaggtc
gtgatcgaccagttcatcacctcgggcgaaaccaagtggggccgcctgtgcggcctgacg
atgatgctgccgcacggctacgacggccagggcccggaacacagctcggcccgcgtcgag
cgctacctgcagatgtgcgccgagcacaacgtccaggtcgtgcagccgtccgaagccagc
cagatcttccacgtgctgcgccggcagatgctgcgcccggtccgcaagcccctgatcatc
atcatgagcaagcggctgctgaaggcgaagtttgccgccagcccgatcgagcagttcagc
agcggcgccttccgcaacgtgatcggcgataccgccgaactcgatgccaagaaggtcaag
cgcgtcctcgtctgcgccggtcaggtgtactacgacctcgccacggcccgtgccgaacgc
gagatcaaggacatcgccatcgtccgcgtcgagcagctgtacccgttcccgaccgaagag
ctgcaggccgagttcgagaagtatccgaacgcccgcgaagtcgtctgggtccaggaagag
ccgcgcaaccagggcgcctggcaccagatccgccaccgcctcgaaggctgcacctcgccg
aagcaggaactcaagttcgcaggtcgcccgtcgtcggcatcgccggccgtcggctacatg
agcaagcacaccgcccagctcaaggccttcgtcgacgaagcactgacgctgtaa

DBGET integrated database retrieval system