KEGG   Juglans regia (English walnut): 109007182Help
Entry
109007182         CDS       T05245                                 

Definition
(RefSeq) glutathione transferase GST 23-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:jre00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    109007182
Enzymes [BR:jre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109007182
Transporters [BR:jre02000]
 Other Transporters
  Pores ion channels [TC:1]
   109007182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Y_phosphatase GST_N_4 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 109007182
NCBI-ProteinID: XP_018842297
UniProt: A0A2I4GEH7
LinkDB All DBs
Position
Unknown
AA seq 225 aa AA seqDB search
MVSQEVKLLGFWASPFSNRVEWALKLKGVDYEYIEEDIFNKSSRLLELNPVHKRVPVLVH
DGKVMAESFILLEYIDETWKQDQLLLPQDPYERSKARFWARVAEEKLLEYSFAAMISHGE
NKEKALKSAIEVAEKIEEEMKGNNKKFLGGESIGYLDLALGWIAHWLPIWEEVGSMQIVD
PSQFPATTAWSKTFLDHPVIKQNLPPRDKMLVYFHELKKILGGSG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtaagccaggaggtgaagcttttgggattttgggcgagcccattttccaacagggtt
gaatgggctctaaagctcaagggtgttgattacgagtatattgaagaagatatcttcaac
aagagctctcgtcttctggaactgaaccctgttcataaaagggttccagtcctggttcat
gacggtaaggtgatggctgagtcgttcattcttcttgaatacatcgacgagacctggaag
caagaccagttattgctgcctcaagatccttatgaaagatccaaagcgcgattctgggct
agagttgcagaagaaaagctgctggagtattcatttgctgctatgatctcccacggagag
aataaagaaaaggcactgaaatcagccatagaggtggcggagaagatagaggaagagatg
aaagggaataacaagaagtttttgggaggggagagcattgggtatttggaccttgcactg
ggatggatagctcactggctgcctatttgggaggaagttggatctatgcagattgtggac
ccttcacaatttcctgccaccactgcctggtcgaagacgtttctggatcacccagtgatc
aagcaaaacttaccacctagagacaaaatgcttgtttattttcacgagctcaagaaaatc
ttgggtggttcagggtag

DBGET integrated database retrieval system