KEGG   Kitasatospora albolonga: B7C62_15845Help
Entry
B7C62_15845       CDS       T05009                                 

Definition
(GenBank) hypothetical protein
Organism
kab  Kitasatospora albolonga
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3656427..3658439
Genome map
AA seq 670 aa AA seqDB search
MFTRIVWRMPPEGSHGRAPFTLCSLQPLLRVVLQRRISIASLRGQAAAPSVGSDLGGVPV
RKFADHFAKQFQGWVETRPDHPAVVFVEDFDEGCGGPVLTYGELDARARALAGGLVAREL
TGERVLLLHPTGLDFAVAILGCFLSGAVGAPAPLPESSGRGDARLTGIVADAGVRQVLTS
PGSRTAVAEWLARAGLKDRVSVHIEAELAEPGAVLPEPDPAALAFLQYTSGSTSDPKGVL
VTHAALAHNEALITRAMGSDENTRSVSWLPHYHDMGLVGQLLGPLFCGGTSYVMSPLAFL
RHPHRWLRAVSELRGTVTVAPDFGYALVTRRTTDRQLAELDLSALRIALNGSEPIHAATL
ERFAERFAPAGLDPAAITPCYGMAETTLLVSSAPVGSGFRSLDVAADALAGHRLVPAKDP
ARSEDPAPGGRTTRLVSSGRVAGFDLRVVDPDTARELPGGHIGEIWLRGGSVAAGYHDNK
DATEATFAARLSDGDGPFLRTGDLGVLLDGELYVTGRRKEMLIVNGRNLYPQDLELTVRT
ADPLFADGSTAVFTAPLSPGGPEVVVAVQEARPGRLRDHDPQTLVTAVRRALLAEHDAHL
GALVLVPVGAVERTTSGKIRRGGMRDRFLSGGLRELFDSRRPTGTDAGGGTKASTAAPSG
LPTTTAGAPR
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
gtgttcacccggatcgtgtggcgcatgcctccggagggaagtcacggccgcgcgccgttt
actttgtgttctcttcaaccacttcttcgggtggtgcttcagcggcgaataagcatcgct
tcactgcggggccaagcagcggctcctagcgtcggttccgacctgggaggtgtgccggtg
agaaagttcgcagaccactttgcgaagcagtttcagggctgggtcgagacacggcccgac
caccccgcggtcgtcttcgtcgaggacttcgacgaaggctgcggcgggcccgtactgacc
tacggagagctggacgcccgggcccgggcgctggccggcgggctggtggcacgcgaactg
accggggagcgggtgctgctgctccacccgacggggctcgacttcgcggtcgcgatcctc
ggctgcttcctgtccggcgcggtcggcgcgcccgccccgctgccggagagcagcggacgc
ggtgacgcccggctgaccggcatcgtcgcggacgccggggtacgccaggtgctcacgagc
cccggctcccgcacggcggtggcggagtggctggcccgcgccggactgaaggaccgggtg
agcgtgcacatcgaggccgaactcgccgagcccggagcggtgttgcccgagcccgacccg
gcggcgctggcgttcctccagtacacctccggttccaccagcgacccgaagggcgtactc
gtcacccacgcggcactggcgcacaacgaggcgctgatcacccgggccatgggctccgac
gagaacacccggtcggtcagctggctgccgcactaccacgacatggggctcgtcggtcag
ctgctcggccccctcttctgcggcggcacctcctacgtcatgtcgcccctggccttcctg
cgccacccgcaccgctggctcagagccgtcagcgagctgcgcggcacggtcaccgtcgca
ccggacttcgggtacgcgctggtcacccggcgcaccaccgaccgccagctcgccgaactc
gacctgtccgccctgcggatcgcgctcaacggctccgagcccatccacgccgccaccctg
gagcggttcgccgaacggttcgcccccgccggtctcgacccggccgccatcaccccctgc
tacggaatggccgaaacgacactgctggtcagcagcgccccggtcggatcgggcttccgc
tcgctcgacgtggccgccgacgcgctcgccggtcaccggctggttcccgccaaggaccca
gcccgctccgaggaccccgctcccggcggccggaccacccggctggtcagcagcggccgg
gtcgccggtttcgacctgcgcgtcgtcgacccggacaccgcccgcgaactgcccggcggg
cacatcggggagatctggctgcggggcggttcggtggccgcgggctaccacgacaacaag
gacgccaccgaggccaccttcgccgcccggctctccgacggcgacggaccgttcctgcgc
accggcgacctcggtgtcctgctcgacggcgagctgtacgtcaccggccgccgcaaggag
atgctgatcgtcaacgggcgcaacctctacccgcaggacctcgaactgaccgtccgcacg
gccgacccgctgttcgccgacggctccaccgccgtgttcaccgcgccgctctcgcccggc
ggccccgaggtggtcgtcgccgtacaggaggcccggcccggacggctgcgcgaccacgac
ccgcagacgctggtgacggccgtccggcgcgccctgctcgccgagcacgacgcccacctg
ggcgcgctggtgctcgtcccggtgggcgcggtcgaacgcaccacgagcggcaagatccgg
cgcggtggcatgcgggaccgcttcctctccggcggactgcgcgagctgttcgacagcagg
cggcccacgggcacggacgcagggggcggcacgaaagccagcaccgccgccccctccggg
ctgcccaccaccacggcaggtgcgccgcgatga

DBGET integrated database retrieval system