KEGG   Kazachstania africana: KAFR_0B03640Help
Entry
KAFR_0B03640      CDS       T02487                                 

Gene name
KAFR0B03640
Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
kaf  Kazachstania africana
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    KAFR_0B03640 (KAFR0B03640)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KAFR_0B03640 (KAFR0B03640)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KAFR_0B03640 (KAFR0B03640)
   00430 Taurine and hypotaurine metabolism
    KAFR_0B03640 (KAFR0B03640)
Enzymes [BR:kaf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     KAFR_0B03640 (KAFR0B03640)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:760368..762164
Genome map
AA seq 598 aa AA seqDB search
MLHRHSAKHRNPRTVFTHKKSDLPPESKLLSYQEQELEKGKLSGVESVDDARPTLANKYK
IPKQGIEEKYAYQLVHNELTLDGNPHLNLASFVNTYSTDEAKRLITENLNKNLADNDEYP
QLIEITQRCISILSQLWHCDENMEPMGCSTTGSSEAIMLGGLAMKKNWVKKMEKAGKPID
KPNIVMSCACQVALEKFARYFDVECRLVPVSAKSHHMLDPSLLHEYVDENTIGLFVIMGT
TYTGHLEDVEDVSNTLTKLEKEHPEWSNTQIPIHVDGASGGFIVPFAFENSHMKEFGLER
WAFNNPRVVSINTSSHKFGLTTPGLGWVLWKDEAYLPQELRFRLKYLGGVEETFGLNFSR
PGFQVVHQYFNFISKGAAGYRETFRRSLFVARVFSHGLLTSNKLKGCFDIVSSIHEKITD
SSTPKGVNEYWESPSLFKPGVPLVAFKLTKEFQAEYSEIPQVLISSMLRARGWIIPNYPL
PKSTDESDKDEVLRVVFRHEMKLDLAQLLLFDIEMVMQRLVNSYRRVCMHVDKKLTESDE
SKGLRRSFIYDMLLTLASPEGEEISEGDLNAKEDELNKKHKKKQEIRERTSRNYRGTC
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgctacatagacattcagctaaacatagaaatcctagaacagtattcactcataaaaag
agtgatttaccacctgaatcgaagctactttcataccaggagcaagaactggaaaaggga
aaactgtccggagttgagtctgtagatgatgcgagacctacgcttgctaataagtataag
attccaaagcagggaattgaagagaagtatgcttatcagctggttcataacgagttgaca
ttggatggtaatcctcatttgaatctggctagctttgtcaatacttacagtaccgatgag
gcaaaaagactaattacagaaaatttaaataaaaatctggcagataacgacgaatatcct
caattgattgagattactcaacgctgtatatcaatcttatcacaattatggcattgcgac
gaaaacatggaaccaatgggctgtagtaccactggttcatctgaagctattatgttaggt
ggcctggcaatgaaaaagaattgggttaaaaagatggagaaagctgggaaaccaattgat
aaaccaaatattgttatgtcatgtgcctgtcaagttgcattagagaaattcgctagatat
tttgacgttgaatgtagattagtgcctgtcagtgctaaatctcatcacatgctagaccct
tctttattgcacgagtacgttgatgaaaatactattggattgtttgtaattatgggtacc
acttataccggccatttagaggatgtagaagacgtttccaatacccttactaaattggaa
aaggagcatcccgaatggtcaaacacacaaattcccattcatgtcgatggtgcctctggt
ggttttatagttccatttgcctttgaaaattctcatatgaaggaatttggcttggaacgc
tgggcttttaataacccaagggtcgttagtataaacactagtagtcataaatttggtctc
actacaccgggtttaggttgggttctttggaaggatgaagcttacttacctcaagaattg
aggttcagattaaagtatttgggtggtgttgaggaaacatttggtctgaatttttcaagg
cctggttttcaagtggttcaccaatattttaactttatatcaaagggagctgctggctac
agagaaacttttagaagatctttattcgttgcaagagtgttttcgcacgggttactaact
tctaataagctaaagggatgttttgatattgtcagtagcattcacgagaaaattactgat
tcatctactccaaaaggggtaaatgaatactgggaatctccaagtttattcaaaccaggt
gtcccactagttgcctttaaattaacaaaagaatttcaagctgaatattctgagattccc
caagtcctcatttcatctatgttgagagctagaggttggattattcctaattatccatta
ccaaaatcaactgatgaatctgacaaggatgaagtgttaagggttgtatttagacatgaa
atgaagctagatttggcacagttactacttttcgatatcgaaatggtcatgcaaagattg
gtcaattcatacaggagagtttgtatgcatgttgataagaaattgactgagtcggacgag
agtaagggattaagacgtagcttcatttatgatatgctattgacgttagcatctccagaa
ggggaagaaatttctgaaggtgatttgaatgcaaaagaggacgaactcaataaaaagcat
aagaagaagcaagaaatcagagaacgtacttccagaaactacagaggcacatgctga

DBGET integrated database retrieval system