KEGG   Kazachstania africana: KAFR_0D00310Help
Entry
KAFR_0D00310      CDS       T02487                                 

Gene name
KAFR0D00310
Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
kaf  Kazachstania africana
Pathway
kaf00010  Glycolysis / Gluconeogenesis
kaf00051  Fructose and mannose metabolism
kaf00052  Galactose metabolism
kaf00500  Starch and sucrose metabolism
kaf00520  Amino sugar and nucleotide sugar metabolism
kaf01100  Metabolic pathways
kaf01110  Biosynthesis of secondary metabolites
kaf01130  Biosynthesis of antibiotics
kaf01200  Carbon metabolism
Module
kaf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kaf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kaf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KAFR_0D00310 (KAFR0D00310)
   00051 Fructose and mannose metabolism
    KAFR_0D00310 (KAFR0D00310)
   00052 Galactose metabolism
    KAFR_0D00310 (KAFR0D00310)
   00500 Starch and sucrose metabolism
    KAFR_0D00310 (KAFR0D00310)
   00520 Amino sugar and nucleotide sugar metabolism
    KAFR_0D00310 (KAFR0D00310)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KAFR_0D00310 (KAFR0D00310)
Enzymes [BR:kaf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     KAFR_0D00310 (KAFR0D00310)
Membrane trafficking [BR:kaf04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    KAFR_0D00310 (KAFR0D00310)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 SpoU_methylase
Motif
Other DBs
NCBI-GeneID: 13885623
NCBI-ProteinID: XP_003956813
UniProt: H2ATH8
LinkDB All DBs
Position
4:44284..45768
Genome map
AA seq 494 aa AA seqDB search
MSFDDLHKASQQQLTTAVDEICKEFEVTPQKLDELTAHFIEQMQMGLSNTDESAENKGLP
MIPSFVTGSPNGTEKGMLFAADLGGTNFRVCSVTLSGDHTYKMEQMKSKIPDELLEDENV
SSEDLFSYLARRTAAFIKKNHPEVTETKDIVKLGFTFSYPVLQTSLNAGTLIRWTKGFNI
PDTVGKDVVQLYQEQLAKQGLGNLKVVALTNDTVGTYLSHCYTSQNTDSMTTGEISEPII
GCIFGTGTNGCYMEELDKVTKLPKEFRDKLAAQGKTHMVINTEWGSFDNELKVLPTTKYD
VYIDQKLSANPGFHLFEKRVSGMFLGELLRNILIDLHSRGLIFNQYRTNEQLPHRLQTPF
ELDSEVLSHIEIDDSTGLRETELSLLQTLRLPTSPTERKEIQKIVRAISRRSAYLAAVPI
AAITIKTGVLSKRYHGEVEVGCDGSVVEYYPGFRSMLRHALALSPLGSEGERKVHLRLAK
DGSGVGAALCALVA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgacgacttacacaaagcaagccaacaacaattaactactgcagtagacgaa
atctgtaaagaattcgaagtcactccacaaaaattggatgaattgactgctcatttcatt
gaacaaatgcaaatgggtctatccaacactgatgaatccgccgaaaataaaggtttacca
atgattccatccttcgtcactggttctccaaacggtactgaaaagggtatgctttttgct
gctgatcttggtggtaccaatttcagagtttgttcagttactttaagtggtgaccacact
tacaaaatggaacaaatgaaatcaaaaattccagatgaattattagaagatgaaaatgtt
agtagtgaagatttattctcctatttagcaagaagaaccgctgctttcattaaaaagaac
catcctgaagttactgaaactaaagatatcgtcaaattaggttttactttctcttaccca
gtcttacaaacttctctaaatgctggtactttaattagatggactaagggtttcaacatt
ccagacaccgttggtaaggatgtcgtccagttgtaccaagaacaattagccaaacaaggc
ttaggtaacttgaaggtcgttgctttaactaacgataccgtcggtacctacttatctcac
tgttacacctctcaaaacactgattcaatgaccactggtgaaatcagcgaaccaatcatc
ggttgtattttcggtaccggtactaacggttgttacatggaagaattagataaagtcact
aagttgccaaaggaatttagagataaactggccgctcaaggtaagactcatatggtcatt
aacactgaatggggttccttcgataatgaattgaaagtcttaccaactactaagtacgat
gtctacattgatcaaaaattaagtgcaaacccaggtttccatttatttgaaaagagagtc
tctggtatgttcttaggtgaactattgagaaatatcttgattgacttacactcccgtggt
ctaatcttcaaccaatacagaaccaatgaacagttacctcaccgtttacaaactcctttc
gaattagattctgaagttttatctcatatcgaaattgatgattctaccggtttaagagaa
actgaattatctttgttacaaactttaagattaccaacctctccaactgaacgtaaggaa
atccaaaagattgtccgtgccatctctcgtagatccgcctacttagctgctgttccaatt
gctgctatcactatcaagactggtgttttaagcaagagataccatggtgaagtcgaagtc
ggttgtgacggttctgtcgtcgaatactacccaggtttcagatccatgttgagacacgct
ttagctttatctccattaggttctgaaggtgaacgtaaagttcatttaagattggccaag
gatggttcaggtgtcggtgccgcattatgtgctttggtcgcttga

DBGET integrated database retrieval system