KEGG   Kutzneria albida: KALB_3352Help
Entry
KALB_3352         CDS       T03039                                 

Definition
(GenBank) Kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
kal  Kutzneria albida
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    KALB_3352
Enzymes [BR:kal01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     KALB_3352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3715397..3716575
Genome map
AA seq 392 aa AA seqDB search
MSDLRDWAEQADLTDPLAWVRERFDLDDGVVYLDGNSLGALPRAVPARVAEVISHQWGRL
RIRSWSESGWWDAPQRIGDRIAPLVGARPGHVVVGDSTSVNVFRAVVSALRMTPGRTEVL
VDATTFPTDGYITESAARMTGARVRAVRPEDVPAELGPDTALVLLNHVDYRTGRLWDMGA
LTGAVHSAGARVLWDLSHSGGALPVELDRHRVDFAVGCTYKYLNGGPGAPAYLYVRPDLL
PELDQPLTGWCSHADPFGMEPRYRPAPGIARARAGTPEIISLLTLDAALDAWDGVDIAQV
RQKSLALTEFFVRCVDELVPGRVRSVTPADESRGSQVSLSCVDAETVMKELIARGVVGDY
RPPDILRFGFTPLYTRHVDALRAAEVLAEVLS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctccgcgactgggccgagcaggccgacctgaccgatccgctcgcctgggtg
cgcgagcgcttcgacctcgacgacggcgtggtctacctggacggcaactcgctgggcgcg
ctgccccgcgcggtgcccgccagggtggccgaggtgatcagccaccagtgggggcggctg
cgcatccgctcctggtccgagagcggctggtgggacgccccgcagcggatcggcgaccgg
atcgccccgctggtcggcgcccggcccggccatgtggtggtcggcgactccaccagcgtc
aacgtgttccgcgccgtggtctcggccctgcgcatgaccccgggccgcaccgaggtcctg
gtggacgccacgaccttccccaccgacggctacatcaccgagtcggcggcacgcatgacc
ggtgcgagggtgcgcgcggtgcggcccgaggacgtgcccgcggagctgggcccggacacc
gccctggtactgctcaaccacgtggactaccgcaccggccggttgtgggacatgggcgcg
ctgaccggggccgtgcactccgctggcgcccgcgtgctctgggacctctcgcacagcggc
ggggcgctgccggtggaactggaccggcaccgggtcgacttcgccgtgggctgcacctac
aagtacctcaacggtggacccggcgcgcccgcgtacctctacgtgcggccggacctgctg
cccgagctggaccagccgctgaccggctggtgctcgcacgccgacccgttcggcatggag
ccgaggtaccggcccgcgccgggcatcgccagggcgcgcgcgggcacgccggagatcatc
tcgctgctgaccctggacgccgccctggacgcctgggacggggtggacatcgcgcaggtg
cggcagaaaagcctggcgctcaccgagttcttcgtgcgctgcgtggacgagttggtgccc
ggccgggtgcgcagcgtgaccccggccgacgagtcgcgtggcagccaggtgtcactgtcc
tgtgtggacgccgagaccgtcatgaaggagctgatcgcccgcggggtcgtcggcgactac
cggccgccggacatcctgcgcttcggcttcaccccgctctacacgcgccacgtggacgcc
ctgcgcgccgccgaggtgctggcggaggtcctctcgtga

DBGET integrated database retrieval system