KEGG   Kutzneria albida: KALB_5539Help
Entry
KALB_5539         CDS       T03039                                 

Definition
(GenBank) hypothetical protein
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
kal  Kutzneria albida
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kal00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    KALB_5539
Enzymes [BR:kal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     KALB_5539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6138773..6139690
Genome map
AA seq 305 aa AA seqDB search
MHIDSVTNDIRRARLGELVATRQCIRIIEAHNPISAIIAENASVSLGSSLGVEEFDGLWS
SSLTDSTLHGLPDIEVLDPQTRLANIRDIFAVTTKPLIMDGDTGGKVEHFEFFVRNMELA
GVSAVIIEDKTGLKRNSLLGTTVKQVSTDVGEFTAKIRRGKAAQRTPEFMIIARIESLIL
DLGMADALTRADAYVAAGADGIMIHSRKSNPGEVLEFAREFRRIHPSVVLISAPTTYNSI
HAKELQSAGFNVIIYANHMLRAAVKAMQDVSMDILRHGRTAEAERRCVGLEHILHIGPAS
ASTRN
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcgactctgtgaccaacgatattcggcgcgcccgtcttggcgaactggtcgcc
acccgtcagtgcattcggatcattgaggcacacaatccgatctcggcgattattgcggaa
aacgcgagcgtgtcgcttggaagcagtctcggcgtcgaggagttcgacggcttgtggtcc
agttcgctgaccgattcgacgcttcacggactgccagatatcgaggtgctcgatccgcag
acccgcttggcgaacatccgcgacattttcgcggtcaccaccaaaccactgattatggac
ggcgataccggggggaaagtcgagcatttcgagttcttcgtgcggaacatggagctggct
ggggtctccgcggtgatcatcgaggacaagaccggcctgaagcgcaactcgctgctcggc
accaccgtcaagcaggtctcgacggacgtcggcgagtttaccgccaagatcaggcgaggt
aaggccgcgcagcgcacaccggagttcatgatcattgcgcggatcgagagtctgatcctg
gacctcggcatggccgacgctctgaccagggcagatgcctacgttgcggccggtgcggac
ggcatcatgattcacagtcgcaagtcgaacccgggtgaggtactggagttcgctcgcgag
ttccgccgcattcacccgtcggtggtgctgatctcggcgcccaccacgtacaactcgatt
cacgcgaaagaacttcagtcggccgggttcaatgtgatcatctatgcgaaccacatgctg
cgcgctgcggtaaaggcgatgcaggacgtgtccatggacattctgcgacacggccgcacc
gccgaggcggagcgccgctgcgtcggcctcgaacacatcttgcatatcggtcccgctagt
gcgagcacgagaaattga

DBGET integrated database retrieval system