KEGG   Kozakia baliensis: A0U89_11210Help
Entry
A0U89_11210       CDS       T04547                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
kba  Kozakia baliensis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kba00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0U89_11210
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A0U89_11210
Enzymes [BR:kba01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A0U89_11210
Peptidoglycan biosynthesis and degradation proteins [BR:kba01011]
 Precursor biosynthesis
  Racemase
   A0U89_11210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2395158..2396279
Genome map
AA seq 373 aa AA seqDB search
MNNFQSRAGGWLQIDLPAIAENYRRLRSHVGRNVSVGAAVKADAYGLGIAQVAPVLHNAG
CRHFFVATVDEGVVLREHIGPDAKIFQLNGPMPGAENVVLAADLHPVLNSREQIAGWRHL
AKQQGRPLPCVLQIDSGMSRFGLSEADIRALGADDALEGLQIELVMSHLACADEPSHPQN
AAQLSRFRALRAHLPEASSSLAASSGIFLGPDFHFDLVRPGYALYGGNPVLGHPNPMRNV
VTLHARLIQDRVIEAGTAVGYSARFVAQRPSRIATLAIGYADGLPRAAGDIATAIHPARP
DVKLPVIGRVSMDCMALDVTDLGDMDLPPGTCFELIGTHRPLDDVASGLDTIGYELLTSL
GRRHHREYIESSL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaacaattttcaatctcgggctggaggctggttgcagatcgacctccccgccatcgcc
gaaaactaccgccgcctacgctcacatgtcggcaggaacgtaagcgtaggcgcggcggtc
aaagcagacgcgtacggactaggaatcgcgcaagtcgcgccagtcctacataacgcggga
tgtcggcatttcttcgtcgcgacagtggatgaaggcgtcgtgctccgcgagcacatcggt
ccggatgcaaagatttttcaactcaacggccccatgcccggtgcggaaaacgtggtctta
gctgccgatctgcaccccgttctcaatagtcgcgaacagatcgcgggctggcggcatctt
gcaaaacaacagggccgtcccctgccctgcgttctgcaaatcgactctggcatgtcacgc
tttggactcagcgaagccgatatcagagcgctcggcgcggacgatgctttggaaggattg
cagatcgagttggtaatgagccatctcgcttgcgccgacgaaccgtctcacccgcaaaat
gccgcccaactgtcgcgctttcgcgcgttgcgtgcgcatctgcccgaagcgtcgtccagc
cttgccgcctcaagcgggatttttctcggaccggatttccatttcgatctcgtccgcccc
ggttatgcgctttacggcggcaacccagtgttgggccatccgaatcctatgcgcaatgtc
gtcacgcttcatgctcgcttgatccaagaccgagttatcgaagcgggaaccgccgtaggt
tacagcgcgcgtttcgtggcgcagcgccccagccgaatcgcaacgctcgctatcggctat
gccgatgggttgccacgcgcggcgggagatatcgccaccgccatccatcccgcgcgtcct
gacgtcaaattgccggtcatcggtcgtgtgtcgatggactgcatggcgctggacgtcacc
gatctgggcgacatggatctgccgcccggcacatgtttcgaactgatcggcacgcatcgc
cccctggacgatgtagcgtcggggttggatacgatcggatatgaacttctgacgtcgctc
gggcgccgtcatcaccgtgaatacatcgagagttctttatga

DBGET integrated database retrieval system