KEGG   Dokdonia sp. 4H-3-7-5: Krodi_2800Help
Entry
Krodi_2800        CDS       T01484                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
kdi  Dokdonia sp. 4H-3-7-5
Pathway
kdi00620  Pyruvate metabolism
kdi00680  Methane metabolism
kdi01100  Metabolic pathways
kdi01120  Microbial metabolism in diverse environments
kdi01200  Carbon metabolism
Module
kdi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kdi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Krodi_2800
  Energy metabolism
   00680 Methane metabolism
    Krodi_2800
Enzymes [BR:kdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Krodi_2800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEE20775
UniProt: F4AWW7
LinkDB All DBs
Position
complement(3166401..3168980)
Genome map
AA seq 859 aa AA seqDB search
MSREPKIERFNTNVKSKYEVYNAIFMTLPFDGISNTGVLLPLFHSICKAGYEDNKNPSEI
IEYFFERYMRDASAKEREDLLFKFIQYIERQVVLFDAIEDASYRIVNNMDGRGTLRNIKE
EAEATGKKEELIAYLNTFKIRPVLTAHPTQFYPGVVLGIINDLSEAIREDRLEDIKSLLA
QLGKTPFFKKEKPTPYDEAVSLIWYLENVFYHSAGAIYDYLHKHLIQDEAFSNSLVDLGF
WPGGDRDGNPFVTTAITLKVARKLRSTVLRNYYRELRQLRRRITFQGTEELLGSLEAALY
KAIFVEGKPEIDQKHILRVLKEVRDVVRDKHQSLYLDHIDSLIHKVELFGLHFASLDIRQ
DSSIHKIVFEEIVAHAQIDGKAIFPENYLSLDDEAQIAFLNDVSGSLDPESFSEEVVTKT
LGSIYAMKTIQEENGEKGSNRYIISNSQSALHVMQAFTFLRLCDWDMPTADVSPLFETVP
DLIAAPEVMEALYTNPTYSAHLKRRGMRQTIMLGFSDGTKDGGYLMANWSIFKAKEAMTA
MSRKYGVTVIFFDGRGGPPARGGGKTHQFYASLGPKIEAQEIQLTVQGQTISSNFGTLDS
CQYNLEQLLSSGVANEVFASANNDITDTDRATLEALAQKSYEAYTAFKQHDKFLPYLERM
STLKYYAKTNIGSRPSKRSQKSTLDFGDLRAIPFVGSWSQLKQNVPGFYGVGTALASFEE
KGTLDEVKELYKNSSFFRTLLENSMMSLTKSFFGLTAYMADDEEFGAFWKILFDEYERSK
RLMLEVSGLKELMENEQAGKASIQERERIVLPLLTIQQYALRAIQEMQKSGEQTDKLAVY
EQMVTRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtctagagaaccaaaaattgagagatttaatacaaacgtaaagtcaaaatatgaagtg
tacaacgctatatttatgacacttccctttgacggtatttcaaatacaggagtacttcta
ccgctttttcattctatttgtaaagcaggatatgaagacaataaaaatccttctgaaatc
attgagtacttttttgaaagatacatgagagatgcttcggcaaaggaaagagaagattta
ctgtttaagtttattcaatatatagaacgccaagtagtactttttgatgcgatagaggat
gcttcatatcgtattgtaaacaatatggacggacgcggaacactgcgtaacataaaagaa
gaagcagaggcaactggtaaaaaagaagagcttattgcttacttaaatacttttaaaata
agaccagtacttactgcacaccctacgcaattttatccaggagttgtgctaggtattatt
aatgatcttagtgaagcaatacgagaagaccgtcttgaagacataaaatcattactggct
caactaggaaaaacacctttctttaagaaagaaaaaccaacgccttatgatgaggcagta
agtttaatatggtacctagaaaatgtgttttaccatagtgcaggtgctatttatgattac
ttacataagcacttaatacaagacgaagcttttagtaactcactagtagatttaggtttt
tggccaggtggagatcgcgatggtaatccatttgtgactacagcaatcacgcttaaagtt
gcacgtaaattacgcagcaccgtactaaggaattattatcgcgaactaagacaactgcgt
cgtcgtataacttttcaaggtactgaggaacttctgggatcattagaggctgcgttgtat
aaagccatctttgtagaaggaaagccagagattgatcaaaaacatattcttagagttctt
aaagaggtgcgagatgtcgtgcgtgataaacatcaaagtttatacttagaccatatagat
agcttaattcacaaagtagaattgtttgggttacattttgcttctctagatataagacaa
gatagtagcatccataaaattgtgtttgaagaaatagtagcacatgctcagatagatggt
aaagctatatttccagagaactacttgagtctagatgacgaagcgcagattgcattttta
aatgatgtttctggctccttagatccagagagttttagtgaagaagttgtcacaaaaaca
cttggttccatttatgccatgaaaaccattcaggaagaaaatggagaaaaaggttccaac
cgttatatcataagtaattcacaaagtgcattgcatgtaatgcaggcgtttacgttctta
agactatgtgattgggatatgcctacagcagatgtttctccgctttttgagaccgttcca
gatttaattgctgctccagaagtgatggaggcgttatatacaaacccaacctacagcgcg
catttaaagcgtcgcggcatgagacagactatcatgctaggcttttctgatggaactaag
gatggtgggtatctcatggcaaactggagtatttttaaagccaaagaagcgatgactgcc
atgtctagaaaatacggagttactgtaatcttctttgacggtagaggaggaccaccagca
cgtggaggcggaaagacacatcaattttatgcatctttaggaccaaaaattgaagcccaa
gaaatacaacttacagtacaaggacaaaccatcagttcaaattttggaacattggattca
tgtcaatataacctggagcaattattaagtagtggtgttgcaaatgaagtttttgcttcc
gcaaataatgatattacagataccgacagagcaacactagaagcactagctcaaaagagt
tatgaagcatatacagcttttaaacagcacgataaattcttgccgtacctagagcgtatg
agtacgcttaagtattatgcaaaaacaaatattggtagtaggccaagtaagcgttctcag
aagtctacgctagattttggggatttaagagccattccttttgtgggaagttggagccaa
cttaaacaaaacgttccaggattttatggcgtaggtactgcgctggcttcttttgaagaa
aaaggaactcttgacgaggtaaaagagctttataagaacagttcattcttccgtacgctg
cttgaaaatagtatgatgagccttaccaagtctttctttggcttaacggcttatatggca
gatgacgaggagtttggtgctttctggaaaattctatttgatgaatatgagcgtagcaag
cgattaatgcttgaagtgtcaggacttaaggagttaatggaaaatgaacaagcaggtaaa
gcttccatacaagaaagggagcgcattgtattaccacttcttaccatccagcaatatgca
ttgagagctatacaagaaatgcaaaaatctggagaacaaacagataagcttgctgtgtat
gagcagatggtgacgagatcattatttggaaatattaatgcgagtagaaactcggcataa

DBGET integrated database retrieval system