KEGG   Komagataeibacter europaeus: S101446_01349Help
Entry
S101446_01349     CDS       T04893                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
keu  Komagataeibacter europaeus
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:keu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    S101446_01349
  Energy metabolism
   00680 Methane metabolism
    S101446_01349
Enzymes [BR:keu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     S101446_01349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1463817..1466621
Genome map
AA seq 934 aa AA seqDB search
MTEAAARTVSDLLQQAEQLIASHDETATGSPVMALARQIGRQMANGALSMEMVEEIVRLL
RDRAFAGRAHHIAAYLDGPDDAVVAARMRDVARRIVQPDPDDSPVPIARFRAAIERSRFA
AVFTAHPTFALANPVYEALADLASTNPAEAPAHVPAFLTHRRVGPPTLDEEFTLATQAIL
RGRNALDRLNIILLSEARTHWPQLWSTLAPRPIIMTSWVGYDTDGRTDIGWWDTLRLRLR
MKQMQLARLHDQIEPVNSSANDLLPRVQTALETVAAQIAACPTGPEPEAVSRFADVLITR
SADALTSTNDLNAAFSEAIDAATPEDKMTLAVARAGFMAHGLSAAHTHTRLNATQLHNIA
RQRLGITDSPDIPAQRRALISRMNDALETVQPVEIDFGSLLMEQASAGRLMMTVRQILRH
IDRTSPIRFLIAETETGYTLLTALWLARLYGVADMIEISPLFETQEALENGEQIIEEALR
SPHWRAYLQRTRKLSLQFGFSDSGRYVGQLAATYLIERLRIKVCDLLRKWDLAFVEVILF
DTHGESIGRGAHPYRLADRFDYLSPPHARARFTRAGIQMREETAFQGGDGYLLFGTQALA
DATVSIIAEHAFATTTLDRDPVYDEPDFSADFFATIANGMTGLVEDPGYAALLGAFGPSL
IDKTGSRPSARQSDAASTVTRIKHPSQLRAIPNNAILQQLAWCANTLQGLGTAAARHPET
FEKYLAESPRFRRAMDFAAHALAHSDHGVLRGVIRLLDPDMWLERATAQKDPGRQEACLS
LMHGLENLDFWASTQAMFRRIQSDHLALRRAWPDAPRMRPDELLLHAIRIAIIEQIWLLS
TQVPYFSPRHAFSRDVLTLKVLCLEIPGALAELENIFPYRSDGSFDLDFHEPHGPRQEGT
YHREYTEIFEPMQRLFQMVREISTGVMHHVGAFG
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgccgcgcggactgtttccgacctgctgcaacaggcggaacaactgatt
gccagccatgacgaaaccgcaaccggcagcccggtcatggcgctggcgcgtcagatcggc
cgccagatggccaatggcgccctgtcgatggaaatggtggaggaaatcgtgcgcctgctg
cgcgaccgggcctttgccgggcgggcgcaccatatcgccgcctatctggatggccccgac
gatgcggtggtcgcggcgcgcatgcgtgacgtcgcccgccgcatcgtgcagccggacccc
gatgacagccccgtacccatcgcgcgcttccgcgccgccatcgaacgcagccgctttgcc
gccgtgttcaccgcccaccccacattcgcgctggccaacccggtatacgaggcactggcg
gacctggcctccaccaacccggccgaggcgccggcgcatgtccctgccttcctgacgcac
cgccgcgtcgggccgcccacgctggatgaggagttcacgctggcgacgcaggccatcctg
cgcggacgcaacgcgctggaccggctgaacatcatcctgctgtccgaagcgcggacccac
tggccgcagttgtggtccacgctggcgccgcgtcccatcataatgaccagctgggttggc
tatgacaccgacggccgcaccgatatcggctggtgggacacgctgcgcctgcggctgcgc
atgaagcagatgcagcttgcgcgcctgcatgaccagatcgaacccgtgaacagcagcgcc
aatgacctgctgccgcgcgtgcagaccgcgctggaaaccgtcgcggcccagatcgccgcc
tgccccaccgggccggaacccgaagcggtgtcacgctttgccgatgtgctgatcacccgc
agcgccgacgcgctgaccagcaccaatgacctgaacgccgccttcagcgaggcgatcgac
gccgcgacccctgaagacaagatgaccctggcggtggcgcgggcgggcttcatggcgcat
ggcctgtcggcagcgcatacgcatacgcgcctgaacgcgacacagctgcataacatcgcc
cggcagcggctgggcattaccgacagccccgacatcccggcccagcgccgcgcgctgatc
agccgcatgaacgacgcgctggagacggtccagccggtcgagatcgatttcggctcgctg
ctgatggaacaggccagcgccgggcggctgatgatgacggtgcgccagatcctgcgccat
atcgaccgcaccagtcccatccgcttcctgattgccgagaccgagaccggctacaccctg
ctgaccgcgctgtggctggcgcggctgtatggcgtggcggacatgatcgagatctcgccc
ctgttcgagacacaggaagcgctggaaaacggcgagcagatcattgaggaagccctgcgc
tccccccactggcgcgcctacctgcagcgcacgcgcaagctcagcctgcagttcggcttt
tccgactccggccgttacgtggggcagctggccgcgacctacctgatcgaacggctgcgc
atcaaggtatgcgacctgctgcgcaaatgggatctggcctttgtcgaggtcatcctgttc
gacacgcacggcgaaagcattggccgtggcgcgcatccctaccggctggcggaccgtttc
gactacctgtccccgccgcacgcccgcgcccgctttacccgcgcaggcatccagatgcgc
gaggaaacggcctttcagggcggtgacggctatcttctgttcggcacgcaggccctggcg
gatgccaccgtcagcatcattgccgaacatgccttcgccaccaccacgctggaccgtgac
ccggtctatgatgaaccggatttctcggccgatttcttcgccaccatcgccaatggcatg
accgggctggtggaagatcccggctatgccgccctgctgggcgcattcgggccatcactg
atcgacaagaccgggtcgcgcccgtccgcccggcagagtgacgcggcatcgaccgtaacc
cgcatcaagcatcccagccagttgcgcgcgattcccaacaacgccatcctgcagcagctg
gcatggtgcgcgaacacgttgcaggggctgggcacggcggcggcgcgccaccccgaaacg
ttcgagaaatacctggcggaaagcccccgcttccgccgcgccatggatttcgcggcccat
gccctggcccattccgaccacggcgtgctgcgcggtgtcatccgcctgctggacccggat
atgtggctggaacgcgccaccgcgcagaaggaccccggccgccaggaagcctgcctgtcg
cttatgcacgggctggaaaacctggatttctgggccagcacgcaggcgatgttccggcgc
atccagtccgatcacctcgccctgcggcgcgcatggcccgacgccccgcgcatgcgccct
gatgaactgctgctgcatgccatccgcatcgcgatcatcgagcagatctggctgctgtcc
acacaggtaccctatttctcgccccggcatgcgttttcgcgtgacgtgctgacgctgaag
gtgctgtgcctggaaatcccgggggcgctggcggaactggaaaatatcttcccctaccgt
tcggatggcagtttcgaccttgatttccatgaaccgcatggcccccggcaggaaggcacc
taccaccgcgaatacaccgagattttcgaaccgatgcagcgcctgttccagatggtgcgc
gaaatcagcaccggagtgatgcaccatgtcggcgcctttggctga

DBGET integrated database retrieval system