KEGG   Komagataeibacter europaeus: S101446_02460Help
Entry
S101446_02460     CDS       T04893                                 

Gene name
ogdH
Definition
(GenBank) Oxoglutarate dehydrogenase (succinyl-transferring)
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
keu  Komagataeibacter europaeus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:keu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    S101446_02460 (ogdH)
  Amino acid metabolism
   00310 Lysine degradation
    S101446_02460 (ogdH)
   00380 Tryptophan metabolism
    S101446_02460 (ogdH)
Enzymes [BR:keu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     S101446_02460 (ogdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2637763..2640636
Genome map
AA seq 957 aa AA seqDB search
MAGVDILSTAFSGANTAYLAELYARWVADPNSVDPSFASLFQELHEDGPEIVHDAEGASW
APRPHIITGDEPLPLPNGKAAGVTAEGLRAAADDSLRATQLIRAFRVRGHLEARLDPLGL
QVPQPHADLDPATYGFGPKDLDRPIYLGHTVASLIGTDTATINQVLDALRSVYCGPIGAE
FMHIQDPEQRMWVQARLEGDNWRKGASPEQKKVILQQLTEAEGFESFCQKRYVGTKRFGL
EGEDVTIPALHAIIDQAAQGGVRSVAIGMPHRGRLNTLVNIVRKPYTAIFSEFAGASFKP
DDVQGSGDVKYHLGTSTDVEIGGTPVHISLQPNPSHLEAVDPVVIGKVRATQDDDDPHQR
GRHMGLLLHGDAAFAGQGIVYETLAMSQLIGYRTGGTIHVVVNNQIGFTTVSVHSFSGLY
CTDVAKAVQAPILHVNGDEPEAVIYCSRLAAEFRQKFASDVVLDIVGYRRHGHNESDEPS
FTQPTMYKAIAARPTIRTLYSDRLVREGVVTEAEVTAEWDGFHNKLEEAYQAAQGYKPNK
ADWLEGAWQGLKPPPVDATRPAPETGVAIDRLKEVGAALAHVPDDFNANSKIVRQLKAKA
KMFETGVGIDWATGEALGFGTLLLDKHHVRLSGEDCQRGTFSQRHAVLIDQINQNTYVPL
NNIAKDQAAIEIYNSLLSEFGVLGFEYGYSLADPNALVLWEAQFGDFANGAQVIIDQFIA
SGETKWLRMSGLVMLLPHGYEGQGPEHSSARLERYLQLCAENNMRVCNLTTPANYYHALR
RQLFLDYRKPLIIMTPKSLLRNKLAVSDLKDFGPGTRFLPVIGEIDQIAAPAKVDRVVIC
SGKVYYDLLTERRERKLDNVAIIRLEQFYPFPEKLLAEELARYPQAKVIWCQEEPENMGG
WNFVDRLIEGVLTSVGHKSTRPTYVGRVAAASPATGLAKVHVAEQTALVNKALGVSA
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgtagatattctttcgaccgcattcagcggcgccaatacggcctatctggcc
gaattgtatgcgcgctgggtggccgatcccaacagcgtcgatccttcctttgcctccctg
ttccaggaactgcacgaggacgggccggaaatcgttcatgatgcggaaggggcgtcgtgg
gcgccacggccgcacatcatcaccggtgatgaacccctgcccctgccgaatggcaaggcg
gcgggtgtaacggccgaagggctgcgggccgcggcggatgacagcctgcgcgcgacacag
ctgatccgggcgttccgcgtgcgtggccaccttgaggcccggctggacccgctgggcctg
caggtgccccagccccatgccgaccttgaccccgcgacctatggcttcggccccaaggat
cttgatcgcccgatctaccttggccacaccgtcgccagcctgatcggaaccgacaccgcg
accatcaaccaggtgctcgatgccctgcgctcggtctattgcgggccgatcggcgccgag
ttcatgcacatccaggatcccgagcagcgcatgtgggtgcaggcgcggctggaaggtgac
aactggcgcaagggcgcaagccccgagcagaagaaggtcatcctgcagcagctgaccgaa
gcggaaggcttcgagtccttctgccagaagcgttatgtcggcaccaagcgcttcggcctt
gagggcgaggacgtgaccattcccgcgctgcacgcgatcattgatcaggcggcacagggc
ggcgtgcgctcggtcgccatcggcatgccgcaccgtggccgcctgaacacgctggtcaac
atcgtgcgcaagccctacaccgccatcttcagcgaattcgccggtgcgtccttcaagccg
gacgacgtgcaggggtcgggcgatgtgaaataccatctcggcacctccaccgatgtcgag
atcggcggcactccggtccatatctcgctccagcccaacccctcgcatctcgaggcggtg
gacccggtcgtgatcggcaaggtccgcgcgacgcaggatgatgacgatccccaccagcgc
ggccgccacatgggcctgctgctgcatggtgacgccgcgttcgccggtcagggcatcgtg
tatgaaacgctggccatgtcgcagctgatcggctaccgcaccggcggcacgatccacgtc
gtggtcaacaaccagatcggcttcaccaccgtttcggtccattccttctccggcctttac
tgcacggacgtggccaaggcggtgcaggccccgatcctgcatgtgaacggtgacgagccg
gaagcggtgatctactgctcccgccttgcggctgaattccgccagaagttcgcatccgac
gtggtgctggacatcgtgggctaccgccgccatggccataacgagtccgatgagccgtcc
ttcacccagcccaccatgtacaaggccattgccgcgcgtccgaccatccgcacgctgtat
tccgaccgtctggtgcgcgaaggtgtcgtgaccgaggcggaggtcacggccgaatgggat
ggtttccataacaagctggaagaagcctatcaggccgcccagggctacaagcccaacaag
gcggactggctggaaggcgcatggcaggggctgaagccgccgccggtggacgccacccgc
cccgcgccggaaaccggtgtcgccattgaccggctgaaggaagtgggcgcggcgctggcg
catgtgcccgatgacttcaacgccaattccaagatcgtccggcagctcaaggccaaggcc
aagatgttcgagacgggcgtgggcatcgactgggccacgggtgaggcgctgggcttcggc
acgctgctgctggacaagcaccatgtccgcctgtcgggcgaggactgccagcgcggcacc
ttcagccagcgtcacgcggtgctgatcgaccagatcaaccagaacacctatgtgccgctg
aacaacatcgccaaggaccaggccgcgatcgagatctacaactcgctgctgtccgaattc
ggggtgctcgggttcgaatacggctattcgctggccgatccgaacgcgctggtgctgtgg
gaagcgcagttcggtgacttcgccaacggtgcgcaggtcatcatcgaccagttcatcgca
tcgggcgagaccaagtggctgcgcatgtccggcctggtcatgctgctgccgcacgggtac
gaagggcaggggccggaacattcctccgcccgtctggagcgttatctccagctctgcgcg
gaaaacaacatgcgcgtgtgcaacctgaccacgccggccaactactatcacgccctgcgt
cgccagctgttcctggattaccgcaagccgctgatcatcatgacgccgaaatccctgctg
cgtaacaagctggcggtatcggacctgaaggatttcggtccgggcacgcgcttcctgccg
gtcattggcgaaatcgaccagatcgcggcccccgccaaggtggaccgcgtggtgatctgt
tcgggcaaggtctattacgacctgctgaccgaacgccgtgagcgcaagctggataacgtc
gccatcatccggctggaacagttctatcccttccccgaaaagctgctggcggaagaactg
gcccgctacccgcaggccaaggtgatctggtgccaggaagagccggaaaacatgggtgga
tggaactttgtcgatcgcctgatcgaaggcgtgctgacatcggtaggccacaagagcaca
cggccgacctatgtcgggcgcgtggcggcggccagccccgccacgggtcttgcgaaggtc
cacgttgccgagcagacagcgctggtgaacaaggcgctgggcgtcagtgcctga

DBGET integrated database retrieval system