KEGG   Kribbella flavida: Kfla_1287Help
Entry
Kfla_1287         CDS       T01155                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
kfl  Kribbella flavida
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kfla_1287
   00620 Pyruvate metabolism
    Kfla_1287
   00630 Glyoxylate and dicarboxylate metabolism
    Kfla_1287
  Energy metabolism
   00680 Methane metabolism
    Kfla_1287
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Kfla_1287
Enzymes [BR:kfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Kfla_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1349577..1350569)
Genome map
AA seq 330 aa AA seqDB search
MSTTPVKVAVTGAAGQIGYSLLFRIASGALLGPDTPVELRLLEITPALKALEGVVMELDD
CAFPTLAKVEIGDDPNTIFDGANVALLVGARPRTKGMERGDLLEANGAIFTGQGKALNDH
AADDIRVTVTGNPANTNALIAKSNAPDIPAERFSALTRLDHNRALAQLAKKTGTSVNDLK
KLTIWGNHSATQYPDIFHAEVAGKNAAEVVNDQTWLENDFIPTVQKRGAAIIEARGASSA
ASAAAATIDHTRDWLRGSADGDWLSMAVVSDGSYGVPEGLISSFPVITKDGNWEIVQGLE
INDFSRGRIDASAAELAEERDAVQQLGLIG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgagcactacccccgtgaaggtcgccgtcaccggcgccgccggccagatcggctacagc
ctgctgttccggatcgccagcggtgcgctgctgggcccggacaccccggtcgagctgcgg
ctgctggagatcaccccggcgctgaaggcgctggagggggtcgtgatggagctcgacgac
tgcgcgttcccgacgctggccaaggtcgagatcggcgacgacccgaacaccatcttcgac
ggcgcgaacgtcgccctgctggtcggcgcccggccgcggaccaagggcatggagcgcggt
gacctgctcgaggccaacggcgcgatcttcaccggccagggcaaggcgctgaacgaccac
gccgccgacgacatccgggtcaccgtcaccggcaacccggccaacaccaacgcgctgatc
gccaagagcaacgcgccggacatcccggccgagcggttctccgcgctgacccggctggac
cacaaccgcgcgctggcacagctggccaagaagaccggcaccagcgtcaacgacctgaag
aagctgacgatctggggcaaccactcggccacccagtacccggacatcttccacgccgag
gtggccggcaagaacgccgccgaggtcgtcaacgaccagacctggctggagaacgacttc
atcccgaccgtgcagaagcgcggcgcggcgatcatcgaggcccgcggcgcctcctcggcc
gcgtcggccgcggcggccacgatcgaccacacccgcgactggctgcgcgggtcggccgac
ggcgactggctgtcgatggcggtcgtgtccgacggctcgtacggcgtaccggaggggctg
atctcgtcgttcccggtgatcaccaaggacggcaactgggagatcgtgcagggcctggag
atcaacgacttctcccgcggccggatcgacgccagtgccgccgagctcgccgaggagcgc
gacgcggtccagcagctcggcctgatcggctga

DBGET integrated database retrieval system