KEGG   Kribbella flavida: Kfla_3309Help
Entry
Kfla_3309         CDS       T01155                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
kfl  Kribbella flavida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ADB32370
UniProt: D2PKQ3
LinkDB All DBs
Position
3548696..3549760
Genome map
AA seq 354 aa AA seqDB search
MQLPVMPPVPPMLAKAVKQIPDGEVSFEPKWDGFRSIIFRDGDEVEIGSRNEKPMTRYFP
ELVEAIKANLPQRCVIDGEIVVIGASGDRLDFEVLQQRIHPAASRVTMLSETTPARFVAF
DLLALGDTDYRERPFVERRAALEEALAPAKAPIHLTRTTTDKAVATEWFHQFEGAGLDGV
IAKPLDGLYEPDKRTMFKIKHERTADCVVAGYRVHKSGPNRIGSLLLGLFTSDGVLASVG
VIGAFPMARREELFEELQPLVTDFDDHPWAWAKQEEGNRTPRNAEGSRWQAGKDLSFVPL
RPERVVEVRYDHMEGVRFRHTAQFVRWRDDRTPESCTYEQLEEPVKFDLADVLG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcagctacccgtgatgccaccggtcccgccgatgctggccaaggcggtcaagcagatc
cccgacggcgaggtcagcttcgagccgaagtgggacggtttccgctcgatcatcttccgc
gacggcgacgaggtcgagatcggcagccggaacgagaagccgatgacccggtactttccc
gagctggtcgaggcgatcaaggcgaatctgccgcaacgctgcgtgatcgacggcgagatc
gtggtgatcggggcgtccggggaccggctcgacttcgaggtgctgcagcaacggatccac
ccggcggcgtcccgggtgacgatgctgtcggagacgacgccggcgcggttcgtcgccttc
gacctgctcgcgctgggcgacaccgactaccgggagcggccgttcgtcgagcggcgtgcc
gcgctcgaggaggcgctcgccccggcgaaggcgccgatccacctgacccggacgacgacc
gacaaggcggtggcgaccgagtggttccaccagttcgagggcgccgggctggacggggtg
atcgcgaagccgctggacgggctgtacgagccggacaagcggaccatgttcaagatcaag
cacgagcggaccgcggactgcgtggtcgccgggtaccgcgtccacaagagcggcccgaac
cggatcggctcgctgctgctcggcctgttcaccagcgacggcgtactggcgagcgtcggc
gtgatcggggcgttcccgatggcgcggcgcgaggagctgttcgaggagttgcagccgctg
gtcaccgacttcgacgaccacccgtgggcctgggcgaagcaggaggagggcaaccgcacc
ccgcgcaacgccgaaggcagccggtggcaggccggcaaggacctgagtttcgtgccgctg
cggccggagcgggtggtcgaggtgcggtacgaccacatggagggcgtgcgtttccggcac
acggcccagttcgtccgctggcgcgacgaccggacgccggagtcgtgcacgtacgagcag
ctcgaggagccggtcaagttcgacctggccgacgtcctgggctga

DBGET integrated database retrieval system