KEGG   Kocuria flava: AS188_07990Help
Entry
AS188_07990       CDS       T04206                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kfv  Kocuria flava
Pathway
kfv00010  Glycolysis / Gluconeogenesis
kfv00071  Fatty acid degradation
kfv00350  Tyrosine metabolism
kfv00625  Chloroalkane and chloroalkene degradation
kfv00626  Naphthalene degradation
kfv01100  Metabolic pathways
kfv01110  Biosynthesis of secondary metabolites
kfv01120  Microbial metabolism in diverse environments
kfv01130  Biosynthesis of antibiotics
kfv01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kfv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AS188_07990
  Lipid metabolism
   00071 Fatty acid degradation
    AS188_07990
  Amino acid metabolism
   00350 Tyrosine metabolism
    AS188_07990
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AS188_07990
   00626 Naphthalene degradation
    AS188_07990
Enzymes [BR:kfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AS188_07990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C adh_short 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ALU39701
UniProt: A0A0U3H9S3
LinkDB All DBs
Position
complement(1793400..1794473)
Genome map
AA seq 357 aa AA seqDB search
MNAQQAPTVQESAATAVPGTMTAAVVTAFGQPLEVKDLPVPEPGPGQVLVKLISTGVCHT
DLHAAHGDWPVQPTPPFVPGHEGVGTVVALGPGVTEVQEGDLVGNAWLASACGHCRNCRT
GWETLCEEQVNGGYSIDGSFGQYMLVDARFAAQIPAGADPYEVAPVLCAGVTVYKGLKMT
EARPGEWVVISGIGGLGHLAVQYAVAMGLRVAAVDVADDKLALARKHGAEITVNAFAEDP
AEAVLAQIPGGADAVLVTAVHPAAFGQAIGMVRRGGTIVFNGLPPGDFPAPIFDIVLKGL
TIRGSIVGTRQDMVEALDFYARGLIHPTYSTRPLEDVNAILDEMEKGKIEGRVVVEY
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccagcaagccccgaccgtccaggagtccgcggccaccgcggtccccggcacc
atgaccgccgccgtcgtcaccgccttcgggcagcccctggaggtcaaggacctcccggtc
cccgagcccggccccggccaggtcctcgtcaagctgatctcgaccggtgtgtgccacacc
gacctgcacgccgcccacggcgactggccggtccagcccaccccgcccttcgtcccgggc
cacgagggcgtgggcacggtggtggccctcggcccgggggtcacggaggtgcaggagggc
gacctcgtgggcaacgcctggctggcctcggcgtgcgggcactgccgcaactgccgcacc
ggctgggagacgctgtgcgaggagcaggtcaacggcggctacagcatcgacgggtccttc
ggccagtacatgctggtcgacgcccgcttcgccgcgcagatccccgcgggcgccgacccg
tacgaggtggcgccggtgctgtgcgccggggtcaccgtctacaagggcctgaagatgacc
gaggcgcggcccggggagtgggtggtgatctccggcatcggcggcctggggcacctggcc
gtgcagtacgcggtggccatgggcctgcgggtcgcggcggtcgacgtcgccgacgacaag
ctggccctcgcccgcaagcacggcgcggagatcaccgtcaacgcgttcgcggaggacccg
gccgaggccgtgctcgcgcagatcccgggcggtgcggacgccgtgctggtgaccgccgtg
cacccggccgcgttcggccaggcgatcggcatggtccgccgcggcgggacgatcgtgttc
aacggtctgccgcccggggacttcccggcgccgatcttcgacatcgtgctcaagggcctg
accatccgcgggtccatcgtgggcacgcgccaggacatggtcgaggccctcgacttctac
gcgcgcggtctgatccacccgacctacagcacccgtccgctcgaggacgtcaacgcgatc
ctcgacgagatggagaagggcaagatcgagggccgcgtggtcgtcgagtactga

DBGET integrated database retrieval system