KEGG   Kluyveromyces lactis: KLLA0C01155gHelp
Entry
KLLA0C01155g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
kla  Kluyveromyces lactis
Pathway
kla00010  Glycolysis / Gluconeogenesis
kla00051  Fructose and mannose metabolism
kla00052  Galactose metabolism
kla00500  Starch and sucrose metabolism
kla00520  Amino sugar and nucleotide sugar metabolism
kla01100  Metabolic pathways
kla01110  Biosynthesis of secondary metabolites
kla01130  Biosynthesis of antibiotics
kla01200  Carbon metabolism
Module
kla_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kla_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLLA0C01155g
   00051 Fructose and mannose metabolism
    KLLA0C01155g
   00052 Galactose metabolism
    KLLA0C01155g
   00500 Starch and sucrose metabolism
    KLLA0C01155g
   00520 Amino sugar and nucleotide sugar metabolism
    KLLA0C01155g
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KLLA0C01155g
Enzymes [BR:kla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     KLLA0C01155g
Membrane trafficking [BR:kla04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    KLLA0C01155g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 MurB_C
Motif
Other DBs
NCBI-GeneID: 2892353
NCBI-ProteinID: XP_452246
UniProt: Q6CUZ3
LinkDB All DBs
Position
C:88084..89529
Genome map
AA seq 481 aa AA seqDB search
MSDPKLTKAVDSICDQFIVTKSKISQLTEYFIDCMEKGLEPCESDISQNKGLPMIPTFVT
DKPSGQEHGVTMLAADLGGTNFRVCSVELLGNHEFKIEQEKSKIPTFFFQDDHHVTSKDL
FQHMALITHQFLTKHHKDVIQDYKWKMGFTFSYPVDQTSLSSGKLIRWTKGFKIGDTVGQ
DVVQLFQQELNDIGLSNVHVVALTNDTTGTLLARCYASSDAARAINEPVIGCIFGTGTNG
CYMEKLENIHKLDPASREELLSQGKTHMCINTEWGSFDNELNHLPTTSYDIKIDQQFSTN
PGFHLFEKRVSGLYLGEILRNILLDLEKQELFDLKESVLKNNPFILTTETLSHIEIDTVE
NDLQDTRDALLKAADLETTFEERVLIQKLVRAISRRAAFLAAVPIAAILIKTNALNQSYH
CQVEVGCDGSVVEHYPGFRSMMRHALALSPIGPEGERDVHLRISKDGSGVGAALCALHAN
Y
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatcctaagttaaccaaggcggttgattctatatgcgatcagttcattgttact
aaatcgaagatatctcagttgactgagtatttcatcgattgtatggaaaagggattagaa
ccctgtgaatcagatatcagtcaaaacaaagggttgcctatgattccgacgtttgtgact
gacaagccatccggtcaggaacatggagtaaccatgttggcagctgatttaggtggtact
aatttcagagtttgctctgtggaactattaggtaatcatgaattcaagattgaacaagag
aagtcaaagattccaactttcttcttccaggacgatcatcatgttaccagtaaggatttg
ttccaacatatggccctgatcacgcatcagtttttgactaaacatcataaggatgtaatt
caagattacaaatggaaaatgggtttcactttttcatatccagtcgatcaaacctccttg
agcagtggtaagttgattagatggaccaagggtttcaagatcggtgatactgttgggcaa
gacgttgttcaactgttccaacaagaattgaacgatattgggttatcaaatgttcatgtg
gttgcattgactaatgacactactggaaccctattggctcgttgttacgcttccagtgat
gcggcaagagccatcaacgaaccagtaattggctgtatctttggtactggtacgaacggc
tgctacatggaaaagcttgaaaatattcacaaattggatccagctagcagagaagaactt
ctgtctcaggggaagacccatatgtgcatcaataccgaatggggctcttttgataatgaa
ctaaatcatttgcctactacaagttatgatattaagattgatcagcagttctccaccaat
cccgggttccacttgtttgaaaaaagggtcagtggtctttatttgggtgaaatacttcgt
aacatactactagaccttgaaaaacaagagttattcgacttgaaggaatctgttttaaag
aacaatccctttattttaaccacagaaactttatcacatatcgaaattgataccgttgag
aacgacttacaggacacaagggatgctcttttaaaggctgctgacttggagaccaccttc
gaagaacgtgtcttgatccaaaaattggtaagagctatttccaggagagctgcattctta
gccgcagtgccaattgctgcaattttgatcaaaaccaacgctttgaaccagagttatcac
tgccaagtagaggttggttgtgacggtagtgtcgttgagcactatccaggattcagatct
atgatgagacatgcattagcactttctccaattggccccgagggtgaacgtgatgtccat
ctacgtatctccaaggatggttccggtgttggcgctgctttgtgtgctttgcatgcaaat
tattaa

DBGET integrated database retrieval system