KEGG   Kluyveromyces lactis: KLLA0F24134gHelp
Entry
KLLA0F24134g      CDS       T01025                                 

Definition
(RefSeq) hypothetical protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
kla  Kluyveromyces lactis
Pathway
kla00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:kla00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    KLLA0F24134g
Enzymes [BR:kla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     KLLA0F24134g
Chromosome [BR:kla03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     KLLA0F24134g
   HMT complexes
    COMPASS/SET1 complex
     KLLA0F24134g
    COMPASS/SET1 complex (yeast)
     KLLA0F24134g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N-SET SET_assoc SET
Motif
Other DBs
NCBI-GeneID: 2895235
NCBI-ProteinID: XP_456155
UniProt: Q6CIT4
LinkDB All DBs
Position
F:2248261..2251263
Genome map
AA seq 1000 aa AA seqDB search
MSGYYNRQYSHFHGNNDRYQTGRYAYQENGNRYKGFQRNGSGNRRYSREGFGSQLRNNEN
ESRPIRSQSRGISEIPRNPFATRPVVSAKYDRDEFNTKYHYYDIVSKRLRNESSFKKWKS
EKIPEHGYVTTTELIASDKQKPILMARQPEQTSVDPRIRPMNGDAVSGSISAKKRYRKLR
SALVRNSRIPYDSFYIGPEPPKEIIVYPSASNQQPIAAALSEAIIKNYFKSFGEIAHFEQ
FMDPNSALPLYVYLIKFTGPVSQPDAPYKAAYKASEKFKDAPYTVSGIKFNVILNQNTVL
NSIKDKLIKQNAARVTEVNKAKRAIAEKSSGQKPQVIRGVPYDLTQVVNNRPVLFVPAKI
TFYHRFNAADFRYQLRKYNWAKIIDHYTGVYIVFHDLENAKACLEYESGALVINSHRTHS
PIQIEFTFIEPKRRLQSNITNQRDINKPRKIEYSSTEELLEASTKQILKDLHNIIKRDIL
RRLVGPIIFDTLNPANYPEVVERQKKLDDEKKKREESQKKTTIKAKPAEFDIFSLYGPAS
KTKKLKRDRKADLGKRHLYTEESPDHQRKKKPKVEHMSHLLNDEISTREDTVDSLNVGSN
GENSPESSGYESEDIISDESKKQSSVITTPEEDLPESAASLPDERSKELLQYEGKYKPIA
SEFPTPVYPYDDFDLNKSKQLSLDKFQLALKDEEDFSILKGIVSEKSKDITTDYTPFLPY
SMWKLYQQIEQNGIIRDNQIALNEKEFDSTLASTTGSFIADGFKKIPDKLKSSYLLHHRR
LAQPLNTVHNHQEQNFMALNGTESTNQEADLEQDNHNASSRLNRVFQRRFQQDIEAQRAA
IGFESDLLSLNQLTKRKKPVTFARSAIHNWGLYALEPIAAKEMIIEYVGESIRQPVAEMR
EKRYIKSGIGSSYLFRIDENTVIDATKRGGIARFINHCCEPSCTAKIIKVDGRKRIVIYA
LRDIGTNEELTYDYKFERETDEGERLPCLCGAPSCKGFLN
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atgagtgggtactataatagacagtactctcattttcatgggaataatgatcggtaccaa
accggacgatatgcatatcaagaaaatgggaataggtacaagggcttccaacggaatgga
tcagggaaccgaagatactcccgcgaggggtttgggtctcaacttaggaataatgagaac
gaatctcgtccaatacggtcgcagtcgcgtggtatcagcgagattcctcgtaatcccttc
gcaacgcgtccagtagtgagtgcgaaatacgatcgcgatgagtttaatacaaaatatcat
tattacgacattgtaagtaaacgactacgaaatgaatccagcttcaagaaatggaaatct
gagaagattcctgagcatggatatgtgacaacaacggagttgattgcatcggataagcaa
aaaccaatactcatggccaggcagcctgaacaaacttcggtggatccgagaatacgtcct
atgaatggggatgcggtctctgggtccatttctgcgaaaaagagatatagaaagcttaga
agtgcattggtacgcaactcgcgaattccgtatgattctttctacattggtcctgaacct
ccaaaagaaatcatagtatacccttctgcatctaaccaacaaccaatagcagccgcatta
tctgaagcaataatcaaaaactactttaaatcatttggtgaaatagcgcattttgaacag
ttcatggatccaaatagtgcattgccattgtacgtctatctaataaaattcactggtcca
gtttctcaacctgatgctccatataaagctgcttataaggcatcagagaaattcaaagac
gcaccttacacagtatcaggtatcaagttcaatgtcattttaaaccaaaatacagtgtta
aattcaataaaggacaaactaatcaaacagaacgcagccagagtgacagaagtgaataaa
gcgaaacgggccattgcagagaaatcatccgggcagaaacctcaagtaataagaggagtg
ccatacgatttaactcaagttgtgaacaacagaccagttttgtttgttcctgcaaagatt
acgttttatcataggttcaatgcagcagatttcagatatcaacttcgtaagtacaattgg
gccaaaattattgatcactacactggcgtatatattgtttttcatgatctggaaaatgca
aaagcatgtttagagtacgaatcaggtgccttggtcataaattcgcataggactcactct
cccatacaaatagaatttactttcattgaaccaaagaggagacttcaatcaaatatcact
aaccaaagagatatcaataaacctcgaaagatagagtactcaagcacggaagagctatta
gaagcctccacaaaacaaattctcaaagatttgcataatatcattaagcgtgatatcttg
agaaggcttgtaggtccaattatatttgatacgctaaatcctgctaactacccggaagtt
gtagaaaggcagaagaaactggacgatgagaagaagaagcgtgaggaatcacaaaagaag
acaacgataaaggccaaacccgcagaatttgatattttcagtctatacggacctgcgtct
aaaacaaaaaagctgaaaagagataggaaagctgatctaggcaaacgtcatttatacact
gaagaatctcctgatcatcaacgtaaaaagaaacctaaggtggaacatatgtcgcatttg
ttaaatgatgaaatttctaccagagaagatacagtggattcactcaatgttggctcaaac
ggtgaaaactctccggagtcatctggatatgaatcggaagatattatttcagatgagtcg
aagaaacagtcttccgtgataacaacaccggaggaagacctgcccgaaagcgctgcatct
ttacctgatgaaaggtccaaggaattactacagtatgaagggaaatacaaacctattgca
tcagaattcccaaccccagtatatccttatgatgactttgacttgaataaatccaagcag
ctttctctcgataagttccagcttgctttgaaagacgaagaagatttctctattctcaag
ggcattgtctcagaaaaatcaaaagatattactactgattatacaccatttttgccgtac
tcaatgtggaagttataccaacagattgaacaaaatggaattattcgggataaccaaata
gctttgaatgaaaaagaatttgattcaacgttagcttcaacgactggtagttttattgct
gatggctttaagaaaattcctgataaactgaaatcttcataccttcttcatcatcggagg
ttggcgcaacctttgaacactgttcataatcatcaagaacagaatttcatggctttgaat
ggaacagaatcaacaaatcaagaggctgacttagagcaagataaccataatgcatcctca
cgtttgaacagagttttccaaagacgtttccagcaagatatagaagcgcaaagagctgca
attggctttgaatctgacctattatcattaaaccaattaacgaaaagaaagaaacccgtc
acttttgcaagatctgcaattcacaattggggcctatatgcattggaacctatagcagcc
aaggaaatgattattgagtatgttggcgaatcaattagacaaccggtcgctgaaatgaga
gagaagagatatatcaagtctggaattggttcaagttatttattcagaattgatgaaaat
acagttatagatgctacaaagaggggtggtatcgctaggtttattaatcactgttgtgaa
cctagttgtacggcaaaaatcatcaaagtcgatggccgaaagaggatcgtcatttacgcg
ttacgtgatattggtaccaatgaagaactaacgtacgattataagtttgaaagggaaact
gatgaaggtgaaagattaccatgtctctgtggtgcaccatcttgcaaagggttcctcaat
tga

DBGET integrated database retrieval system